DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpa3 and CG7025

DIOPT Version :9

Sequence 1:NP_031779.1 Gene:Cpa3 / 12873 MGIID:88479 Length:417 Species:Mus musculus
Sequence 2:NP_609133.2 Gene:CG7025 / 34042 FlyBaseID:FBgn0031930 Length:429 Species:Drosophila melanogaster


Alignment Length:396 Identity:125/396 - (31%)
Similarity:218/396 - (55%) Gaps:21/396 - (5%)


- Green bases have known domain annotations that are detailed below.


Mouse    19 VHFDREKVFRVKLQNEKHASVLKNLTQSIE-LDFWY--PDAIHDIAVNMTVDFRVSEKESQTIQS 80
            :.:|...|::||.:.:...|:|:.|.:..| ...|:  .|.:|         ..:|......:::
  Fly    27 LRYDNYSVYKVKFETQAQRSILRKLAEDRENFRLWHEAKDELH---------LMLSPGAFGELET 82

Mouse    81 TLEQHKIHYEILIHDLQEEI--EKQFDVKDEIAGRHSYAKYNDWDKIVSWTEKMLEKHPEMVSRI 143
            .:::..:..|:.|.::||.|  |:..::|....|...:.|||...:|.:|.:.:|..:|.:....
  Fly    83 EIQKTNVTAELFISNVQELIDSEEAANLKASRDGTFGWTKYNSLAEIYAWLDDILAAYPTITESF 147

Mouse   144 KIGSTVEDNPLYVLKIGKKDGERKAIFMDCGIHAREWISPAFCQWFVYQATKSYGKNKIMTKLLD 208
            .:|.:.|...:..:||..| .....:.::..|||||||:.|...|.:.:...|  .::::..|.:
  Fly   148 IVGQSYEGRTIRGIKISYK-SNNPGVLIESNIHAREWITSATATWLINEFLTS--TDELVRDLAE 209

Mouse   209 RMNFYVLPVFNVDGYIWSWTQDRMWRKNRSRNQNSTCIGTDLNRNFDVSW-DSSPNTNKPCLNVY 272
            ..::|::||.||||::::..:||||||.|..::.|:|||.|.|||:|..| ::...::.||...|
  Fly   210 NHDWYIVPVLNVDGFVYTHEKDRMWRKTRQPSEISSCIGADPNRNYDSHWMENEGASSNPCAEDY 274

Mouse   273 RGPAPESEKETKAVTNFIRSHLNSIKAYITFHSYSQMLLIPYGYT-FKLPPNHQDLLKVARIATD 336
            .||.|.||.|.:|::.|:.|..:.|...:.||||||:||.|||:| .:.|||..|:::||:...|
  Fly   275 GGPKPFSEPEIQAMSEFVISIKDKINVLLAFHSYSQLLLSPYGHTKEEFPPNFDDMMEVAKAYGD 339

Mouse   337 AL-STRYETRYIYGPIASTIYKTSGSSLDWVY-DLGIKHTFAFELRDKGKSGFLLPESRIKPTCK 399
            |: |..|.|.|.||..|..:|..||:::||.| :.|::.::..|.||.|:.||:||...|.|..:
  Fly   340 AVESLPYGTVYRYGSAAGILYPASGATIDWAYNEQGVEISYTIEFRDTGRYGFILPPVHIIPNAE 404

Mouse   400 ETMLSV 405
            |.::.:
  Fly   405 EALIGI 410

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpa3NP_031779.1 Propep_M14 28..102 CDD:280416 15/78 (19%)
Peptidase_M14_like 114..413 CDD:299699 105/296 (35%)
CG7025NP_609133.2 Propep_M14 36..103 CDD:280416 14/75 (19%)
M14_CP_A-B_like 123..416 CDD:199844 104/291 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167848051
Domainoid 1 1.000 233 1.000 Domainoid score I2384
eggNOG 1 0.900 - - E1_COG2866
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 267 1.000 Inparanoid score I3018
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D208397at33208
OrthoFinder 1 1.000 - - FOG0000056
OrthoInspector 1 1.000 - - mtm8747
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1730
SonicParanoid 1 1.000 - - X86
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1110.830

Return to query results.
Submit another query.