DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpa3 and CG3108

DIOPT Version :9

Sequence 1:NP_031779.1 Gene:Cpa3 / 12873 MGIID:88479 Length:417 Species:Mus musculus
Sequence 2:NP_572262.1 Gene:CG3108 / 31506 FlyBaseID:FBgn0029807 Length:1132 Species:Drosophila melanogaster


Alignment Length:414 Identity:127/414 - (30%)
Similarity:207/414 - (50%) Gaps:28/414 - (6%)


- Green bases have known domain annotations that are detailed below.


Mouse    21 FDREKVFRVKLQNEKHASVLKNLTQSIELDFWYPDAIHDIAVNMTVDFRVSEKESQTIQSTLEQH 85
            :|..:|:|:.:|.:|...:...|....:...|.       .|...||:.:..:.....:..:...
  Fly   723 YDGAQVWRIVVQTDKDKRMADELQSKYDGQLWK-------EVKQEVDYLLKPQVLAAAERHIRAA 780

Mouse    86 KIHYEILIHDLQEEIEKQFDVKDEIA-------GRHSYAKYNDWDKIVSWTEKMLEKHPEMVSRI 143
            .:...:||.:||..|||:....::||       .|.::..|:..:.|..:.:.|.:.:|::.|..
  Fly   781 NLSRIVLIDNLQRVIEKENPPAEKIAELQNRKGHRLTWQAYHRLEDIHGFIDYMAKTYPDICSTE 845

Mouse   144 KIGSTVEDNPLYVLKIGKKDGERKAIFMDCGIHAREWISPAFCQWFVYQATKSYGKNKIMTKLLD 208
            .||.:||..||.:|||...:.....|::|.|:|||||||||...:...|..:.:   :.:.:.:.
  Fly   846 IIGYSVEKRPLKILKISNGNARNPGIWIDGGMHAREWISPATVTYIANQLVEGW---EDLPEHMR 907

Mouse   209 RMNFYVLPVFNVDGYIWSWTQDRMWRKNRSRNQNSTCIGTDLNRNFDVSWDSSPNTNKPCLNVYR 273
            .:|:|:.||.|.|||.:|.|.||:|||| .|.....|.|.||||||...|.....:..||...||
  Fly   908 SINWYIHPVANPDGYEYSHTTDRLWRKN-MRAHGRQCPGVDLNRNFGYKWGGKGTSASPCSQTYR 971

Mouse   274 GPAPESEKETKAVTNFIRSH-LNSIKAYITFHSYSQMLLIPYGYTFKLPPNHQDLLKVARIATDA 337
            |....||.||..::.||... ..:.:||::||||.|.:|.|:||.::|..:..||.:|||.|..:
  Fly   972 GSKAFSEPETFYISKFISGFPRETFQAYLSFHSYGQYILYPWGYDYQLTQDRADLDRVARQAGTS 1036

Mouse   338 LSTRYETRYIYGPIASTIYKTSGSSLDWVYDL-GIKHTFAFELRDKGKSGFLLPESRIKPTCKET 401
            ::.....:|..|..|:|:|..:|.|.||...: |||:.:..|:.|.|:.||:||...|:...|:.
  Fly  1037 ITKSTGVKYTVGSSATTLYPAAGGSDDWAKGIAGIKYAYTIEMGDTGRYGFVLPARFIQYNGKDG 1101

Mouse   402 MLSVKFIA--------KYILKNTS 417
            :.....:|        |.:.:|:|
  Fly  1102 VTFADTVARAIAQGRGKSVARNSS 1125

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpa3NP_031779.1 Propep_M14 28..102 CDD:280416 13/73 (18%)
Peptidase_M14_like 114..413 CDD:299699 105/308 (34%)
CG3108NP_572262.1 Propep_M14 730..797 CDD:280416 13/73 (18%)
M14_CP_A-B_like 821..1112 CDD:199844 104/294 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167848013
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2866
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D208397at33208
OrthoFinder 1 1.000 - - FOG0000056
OrthoInspector 1 1.000 - - mtm8747
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1730
SonicParanoid 1 1.000 - - X86
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
87.780

Return to query results.
Submit another query.