DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpa3 and CG3097

DIOPT Version :9

Sequence 1:NP_031779.1 Gene:Cpa3 / 12873 MGIID:88479 Length:417 Species:Mus musculus
Sequence 2:NP_572259.1 Gene:CG3097 / 31503 FlyBaseID:FBgn0029804 Length:445 Species:Drosophila melanogaster


Alignment Length:447 Identity:136/447 - (30%)
Similarity:227/447 - (50%) Gaps:40/447 - (8%)


- Green bases have known domain annotations that are detailed below.


Mouse     1 MRFFLLMAVIYTTLA-------------IAPVHFDREKVFRVKLQNE---KHASVLKNLTQSIEL 49
            ::..||:|.:..:||             ..|..:|..:::|:...:|   |...|.:.|.|....
  Fly     8 LQLLLLVAAVAASLANELPSNLTLLDANEIPQRYDEAQLWRIYNISEAMQKRVPVGQMLEQKFGG 72

Mouse    50 DFWYPDAIHDIAVNMTVDFRVSEKESQTIQSTLEQHKIHYEILIHDLQEEIEKQF---------- 104
            :.|..:       :..:|..::..:.:..:|.|..|::..:||.|::|..|:::.          
  Fly    73 NIWKEN-------SKFLDISIARDQLKAARSFLSAHRLDPQILSHNIQSMIDEELLEGIQSSSFG 130

Mouse   105 -DVKDEIAGRHS--YAKYNDWDKIVSWTEKMLEKHPEMVSRIKIGSTVEDNPLYVLKIGKKDGER 166
             ..:.:.|.|.|  :..|:|.:.|.|:..::..|.|.:|....||.|.|...|.||:|.:...|.
  Fly   131 HGRRTKKAARSSMHWKDYHDLETIYSFMREIRTKFPNIVRLYTIGQTAEGRDLKVLRISENPREN 195

Mouse   167 KAIFMDCGIHAREWISPAFCQWFVYQATKSYGKNKIMTKLLDRMNFYVLPVFNVDGYIWSWTQDR 231
            |.:::|.|||||||||||...:.:||....:.......:   .:.:|::||.|.|||.:|.|.:|
  Fly   196 KKVWIDGGIHAREWISPATVTFILYQLMSDWENQPAHIR---GLTWYIMPVMNPDGYEYSRTTNR 257

Mouse   232 MWRKNRSRNQNSTCIGTDLNRNFDVSWDSSPNTNKPCLNVYRGPAPESEKETKAVTNFIRSHLNS 296
            :||||||.::.:.|.|.|||||||:.|:...::..||.:.|||.||.||:||:||..|:.....:
  Fly   258 LWRKNRSPSRRAQCSGVDLNRNFDIGWNGYGSSTNPCSDTYRGSAPASERETRAVAEFLAKRKYN 322

Mouse   297 IKAYITFHSYSQMLLIPYGYTFKLPPNHQDLLKVARIATDALSTRYETRYIYGPIASTIYKTSGS 361
            :::|:|||||.||::.|:.|......:...|.:|:.:|.:.:..:..|.|........:....|.
  Fly   323 LESYLTFHSYGQMIVYPWAYKAVKVKDASVLQRVSSLAAERILQKTGTSYRAAVTHEVLGIAGGG 387

Mouse   362 SLDWV-YDLGIKHTFAFELRDKGKSGFLLPESRIKPTCKETMLSVKFIAKYILKNTS 417
            |.||. ..||:|:.:..||||:|..||:||...||.|..|....|:.:|:.|..::|
  Fly   388 SDDWSRAALGVKYVYTIELRDRGAYGFVLPPRFIKDTALEGWTVVETVAQAIGPSSS 444

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpa3NP_031779.1 Propep_M14 28..102 CDD:280416 16/76 (21%)
Peptidase_M14_like 114..413 CDD:299699 109/301 (36%)
CG3097NP_572259.1 Propep_M14 64..118 CDD:280416 12/60 (20%)
M14_CP_A-B_like 148..439 CDD:199844 108/293 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167848014
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2866
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D208397at33208
OrthoFinder 1 1.000 - - FOG0000056
OrthoInspector 1 1.000 - - mtm8747
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X86
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
87.750

Return to query results.
Submit another query.