DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PROKR2 and Oamb

DIOPT Version :9

Sequence 1:NP_658986.1 Gene:PROKR2 / 128674 HGNCID:15836 Length:384 Species:Homo sapiens
Sequence 2:NP_001262774.1 Gene:Oamb / 43982 FlyBaseID:FBgn0024944 Length:751 Species:Drosophila melanogaster


Alignment Length:156 Identity:52/156 - (33%)
Similarity:84/156 - (53%) Gaps:13/156 - (8%)


- Green bases have known domain annotations that are detailed below.


Human    39 EDEDMTKTRTFFAAKIVIGIALAGI--MLVCGIGNFVFIAALTRYKKLRNLTNLLIANLAISDFL 101
            |.||:.|:..:.....:|.:|:...  :||.| ||.:.|||:....|||::||..|.|||::|.|
  Fly     5 ECEDLIKSVKWTEPANLISLAVLEFINVLVIG-GNCLVIAAVFCSNKLRSVTNFFIVNLAVADLL 68

Human   102 VAIICCPFEMDYYVVRQLSWEHGHVLCASVNYLRTVSLYVSTNALL---AIAIDRYLAIVHPLK- 162
            |.:...||...:.|.:  .|..|.:.|   .....|.:::.|.::|   ||::|||:|:..|:. 
  Fly    69 VGLAVLPFSATWEVFK--VWIFGDLWC---RIWLAVDVWMCTASILNLCAISLDRYVAVTRPVTY 128

Human   163 PR-MNYQTASFLIALVWMVSILIAIP 187
            |. |:.:.|..|||.:|::|..|..|
  Fly   129 PSIMSTKKAKSLIAGIWVLSFFICFP 154

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PROKR2NP_658986.1 7tm_4 66..>220 CDD:304433 45/127 (35%)
7tm_1 70..329 CDD:278431 43/123 (35%)
OambNP_001262774.1 7tm_4 29..>154 CDD:304433 45/130 (35%)
7tm_1 37..>181 CDD:278431 43/123 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.