DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PROKR2 and Oct-TyrR

DIOPT Version :9

Sequence 1:NP_658986.1 Gene:PROKR2 / 128674 HGNCID:15836 Length:384 Species:Homo sapiens
Sequence 2:NP_001163494.1 Gene:Oct-TyrR / 42452 FlyBaseID:FBgn0004514 Length:601 Species:Drosophila melanogaster


Alignment Length:274 Identity:67/274 - (24%)
Similarity:116/274 - (42%) Gaps:69/274 - (25%)


- Green bases have known domain annotations that are detailed below.


Human    20 HASSLSFNFSYGDYDLPMDEDEDMTKTRTFFAAKIVIGIALAGIMLVCGIGNFVFIAALTRYKKL 84
            |||.|....:..:::                  .::..:.|:.|:::..|||.:.|.::..||.|
  Fly    94 HASILGLQLAVPEWE------------------ALLTALVLSVIIVLTIIGNILVILSVFTYKPL 140

Human    85 RNLTNLLIANLAISDFLVAIICCPFEMDYYVVRQLSWEHGHVLCASVNYLRTVSLYVSTNALL-- 147
            |.:.|..|.:||::|..||::..||.:.|.::.:  ||.|..||   ....|..:...|:::|  
  Fly   141 RIVQNFFIVSLAVADLTVALLVLPFNVAYSILGR--WEFGIHLC---KLWLTCDVLCCTSSILNL 200

Human   148 -AIAIDRYLAIVHPLKPRMNY---QTAS---FLIALVWMVSILIAIPSAYFATETVLFIVKSQEK 205
             |||:|||.||..|:    ||   :|..   .||:.||::|:||:.|                 .
  Fly   201 CAIALDRYWAITDPI----NYAQKRTVGRVLLLISGVWLLSLLISSP-----------------P 244

Human   206 IFCGQIWPVD-------QQLYYKSYFLFIFGVEFVGPVVTMTLCYARISRELWFKAVPGFQTEQI 263
            :.....||.:       :....:.|.::.....|..|:..||:.|..|     |.|.    ..::
  Fly   245 LIGWNDWPDEFTSATPCELTSQRGYVIYSSLGSFFIPLAIMTIVYIEI-----FVAT----RRRL 300

Human   264 RKRLRCRRKTVLVL 277
            |:|.|..:...:.|
  Fly   301 RERARANKLNTIAL 314

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PROKR2NP_658986.1 7tm_4 66..>220 CDD:304433 48/169 (28%)
7tm_1 70..329 CDD:278431 60/224 (27%)
Oct-TyrRNP_001163494.1 Zinc_peptidase_like <113..244 CDD:301362 48/156 (31%)
7tm_1 126..>293 CDD:278431 54/197 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.