DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PROKR2 and Lkr

DIOPT Version :9

Sequence 1:NP_658986.1 Gene:PROKR2 / 128674 HGNCID:15836 Length:384 Species:Homo sapiens
Sequence 2:NP_647968.3 Gene:Lkr / 38622 FlyBaseID:FBgn0035610 Length:542 Species:Drosophila melanogaster


Alignment Length:383 Identity:100/383 - (26%)
Similarity:183/383 - (47%) Gaps:46/383 - (12%)


- Green bases have known domain annotations that are detailed below.


Human    19 DHASSLSFNFSYGDYDLPMDEDEDMTKTRTFFAAKIV--IGIALAGIMLVCGIGNFVFIAALTRY 81
            :..|.|.|        ||..|:|...:......|:||  :.|...||.:|..|||.:.|..:...
  Fly     7 EQESRLEF--------LPGAEEEAEFERLYAAPAEIVALLSIFYGGISIVAVIGNTLVIWVVATT 63

Human    82 KKLRNLTNLLIANLAISDFLVAIICCPFEMDYYVVRQLSWEHGHVLCASVNYLRTVSLYVSTNAL 146
            :::|.:||:.|||||.:|.::.:.|.||:....:::  ||.....:|:...:::.:|:.||...|
  Fly    64 RQMRTVTNMYIANLAFADVIIGLFCIPFQFQAALLQ--SWNLPWFMCSFCPFVQALSVNVSVFTL 126

Human   147 LAIAIDRYLAIVHPLKPRMNYQTASFLIALVWMVSILIAIPSAY-FATETVLFIVKSQEKI---- 206
            .||||||:.||::||:.|.....:.|:|..:||:::|.|:|.|. |..|.:....:...:.    
  Fly   127 TAIAIDRHRAIINPLRARPTKFVSKFIIGGIWMLALLFAVPFAIAFRVEELTERFRENNETYNVT 191

Human   207 --FCGQIWPVDQQLYYKSYFLFIFGVEFVGPVVTMTLCYARISRELWFKAVPG-FQTEQIRKRLR 268
              ||......|.||....|.| :| |:::.|...::..|.:::..||....|| .|..:....|:
  Fly   192 RPFCMNKNLSDDQLQSFRYTL-VF-VQYLVPFCVISFVYIQMAVRLWGTRAPGNAQDSRDITLLK 254

Human   269 CRRKTVLVLMCILTAYVLCWAPFYGFTIVRDFFPTVFVKEKHYLT-AFYVVECIAMSNSMIN--- 329
            .::|.:.:|:.::..:.|||.|...:.|:....|.  :.:.|::: .::..:.:|||||..|   
  Fly   255 NKKKVIKMLIIVVIIFGLCWLPLQLYNILYVTIPE--INDYHFISIVWFCCDWLAMSNSCYNPFI 317

Human   330 ----------------TVCFVTVKNNTMKYFKKMMLLHWRPSQ-RGSKSSADLDLRTN 370
                            ..||...| .:|...::...:|.|.|. |.:.:::.:.:|:|
  Fly   318 YGIYNEKFKREFNKRFAACFCKFK-TSMDAHERTFSMHTRASSIRSTYANSSMRIRSN 374

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PROKR2NP_658986.1 7tm_4 66..>220 CDD:304433 50/160 (31%)
7tm_1 70..329 CDD:278431 74/267 (28%)
LkrNP_647968.3 7tm_4 46..329 CDD:304433 77/288 (27%)
7tm_1 52..318 CDD:278431 75/271 (28%)
PHA03216 467..>519 CDD:177558
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.