Sequence 1: | NP_658986.1 | Gene: | PROKR2 / 128674 | HGNCID: | 15836 | Length: | 384 | Species: | Homo sapiens |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001014559.1 | Gene: | DopEcR / 38539 | FlyBaseID: | FBgn0035538 | Length: | 322 | Species: | Drosophila melanogaster |
Alignment Length: | 314 | Identity: | 65/314 - (20%) |
---|---|---|---|
Similarity: | 110/314 - (35%) | Gaps: | 95/314 - (30%) |
- Green bases have known domain annotations that are detailed below.
Human 41 EDMTKTRTFFAAKIVIGIALAGIMLVCGIGNFVFIAALTRYKKLRNLTNLLIANLAISDFLVAII 105
Human 106 CCPFEMDYYVVRQLSWEHGHVLCASVNYLRTVSLYVSTNALLAIAIDRYLAIVHPLKPRMNYQT- 169
Human 170 -----ASFLIALVWMVSILIAIP------------------------SAYFATETVL-------- 197
Human 198 ------FIVKSQEKIFCGQIWPVDQQLYYKSY--------------FLFIFGVEFV--------- 233
Human 234 ---GPVVTMTL-----CYARISRELWFKAVPGFQTEQIRKRLR-------CRRK 272 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
PROKR2 | NP_658986.1 | 7tm_4 | 66..>220 | CDD:304433 | 44/197 (22%) |
7tm_1 | 70..329 | CDD:278431 | 59/285 (21%) | ||
DopEcR | NP_001014559.1 | 7tm_classA_rhodopsin-like | 18..289 | CDD:410626 | 57/283 (20%) |
TM helix 1 | 18..42 | CDD:410626 | 7/28 (25%) | ||
TM helix 2 | 51..73 | CDD:410626 | 8/21 (38%) | ||
TM helix 3 | 89..111 | CDD:410626 | 5/21 (24%) | ||
TM helix 4 | 134..150 | CDD:410626 | 2/15 (13%) | ||
TM helix 5 | 174..197 | CDD:410626 | 5/22 (23%) | ||
TM helix 6 | 230..252 | CDD:410626 | 3/21 (14%) | ||
TM helix 7 | 264..289 | CDD:410626 | 4/24 (17%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |