DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PROKR2 and AkhR

DIOPT Version :9

Sequence 1:NP_658986.1 Gene:PROKR2 / 128674 HGNCID:15836 Length:384 Species:Homo sapiens
Sequence 2:NP_995639.1 Gene:AkhR / 33942 FlyBaseID:FBgn0025595 Length:455 Species:Drosophila melanogaster


Alignment Length:306 Identity:71/306 - (23%)
Similarity:148/306 - (48%) Gaps:54/306 - (17%)


- Green bases have known domain annotations that are detailed below.


Human    56 IGIALAGIMLVCG-IGNFVFIAALTRYKKLRN--LTNLLIANLAISDFLVAIICCPFEMDY-YVV 116
            :.|.:..|:.|.. |||...:..||: ::||.  ..::::.:|||:|.:|.::..|.|:.: :.|
  Fly    40 LSITVYSILFVISTIGNSTVLYLLTK-RRLRGPLRIDIMLMHLAIADLMVTLLLMPMEIVWAWTV 103

Human   117 RQLSWEHGHVLCASVNYLRTVSLYVSTNALLAIAIDRYLAIVHPLKPRMNYQTASFLIALVWMVS 181
            :.||.:   ::|..:::.|...||:|:..::.|::|||.||:.|||  .:|.....::|..|:.|
  Fly   104 QWLSTD---LMCRLMSFFRVFGLYLSSYVMVCISLDRYFAILKPLK--RSYNRGRIMLACAWLGS 163

Human   182 ILIAIPSAYFATETVLFIVKS--------QEKIFCGQIWPVDQQLYYKSYFLFIFGVEFVGPVVT 238
            ::.:||.|:      ||.::.        |..||.......|::||..:....::..    |::.
  Fly   164 VVCSIPQAF------LFHLEEHPAVTGYFQCVIFNSFRSDFDEKLYQAASMCSMYAF----PLIM 218

Human   239 MTLCYARISRELWFKA---VPGFQTEQIRKR-----LRCRRKTVLVLMCILTAYVLCWAPFYGFT 295
            ...||..|..|::.|:   :.....|:.|:.     .|.:::|:.:.:.|:..:::||.|:|..:
  Fly   219 FIYCYGAIYLEIYRKSQRVLKDVIAERFRRSNDDVLSRAKKRTLKMTITIVIVFIICWTPYYTIS 283

Human   296 IVRDFFPTVFVKEKH--------YLTAFYVVECIAMSNSMINTVCF 333
            :       .:..:||        ...|.::   .|.:||.:|.:.:
  Fly   284 M-------WYWLDKHSAGKINPLLRKALFI---FASTNSCMNPLVY 319

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PROKR2NP_658986.1 7tm_4 66..>220 CDD:304433 46/165 (28%)
7tm_1 70..329 CDD:278431 66/285 (23%)
AkhRNP_995639.1 7tm_1 55..319 CDD:278431 67/289 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.