DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PROKR2 and CCKLR-17D3

DIOPT Version :9

Sequence 1:NP_658986.1 Gene:PROKR2 / 128674 HGNCID:15836 Length:384 Species:Homo sapiens
Sequence 2:NP_001097023.1 Gene:CCKLR-17D3 / 32864 FlyBaseID:FBgn0030954 Length:584 Species:Drosophila melanogaster


Alignment Length:465 Identity:100/465 - (21%)
Similarity:176/465 - (37%) Gaps:146/465 - (31%)


- Green bases have known domain annotations that are detailed below.


Human    17 PQDHASSLSFNFSYGDYDLPMDEDEDMTKTRTFFAAKIVIGIALAGIMLVCGIGNFVFIAALTRY 81
            |.|..:.|:|:........|.......:.|.|.....::...::  |:|...:||.:.|:.|.:.
  Fly    77 PSDLVTELAFSLGTSSSPSPSSTPASSSSTSTGMPVWLIPSYSM--ILLFAVLGNLLVISTLVQN 139

Human    82 KKLRNLTNLLIANLAISDFLVAIICCPFEMDYYVVRQLSWEHGHVLCASVNYLRTVSLYVSTNAL 146
            :::|.:||:.:.||||||.|:.::|.|..:...::|...:  |..||....:.:..|:.||:..|
  Fly   140 RRMRTITNVFLLNLAISDMLLGVLCMPVTLVGTLLRNFIF--GEFLCKLFQFSQAASVAVSSWTL 202

Human   147 LAIAIDRYLAIVHPLKPRMNYQTASF---LIALVWMVSILIAIPSAYFATETVLFIVKSQEKIF- 207
            :||:.:||.||.|||:.| ::||.|.   :|..:|:..||...|.|.|:.     ::.:....: 
  Fly   203 VAISCERYYAICHPLRSR-SWQTISHAYKIIGFIWLGGILCMTPIAVFSQ-----LIPTSRPGYC 261

Human   208 -CGQIWPVDQ--QLYYKSYFLFIFGVEFVGPVVTMTLCYARISRELWFKAV-------------- 255
             |.:.|| ||  :|:|.....|:.   .|.|::.:.:.|..|:|.|:....              
  Fly   262 KCREFWP-DQGYELFYNILLDFLL---LVLPLLVLCVAYILITRTLYVGMAKDSGRILQQSLPVS 322

Human   256 ----------PGFQTE------------------------------------------------- 261
                      ||..:.                                                 
  Fly   323 ATTAGGSAPNPGTSSSSNCILVLTATAVYNENSNNNNGNSEGSAGGGSTNMATTTLTTRPTAPTV 387

Human   262 -----------------QIR------------KRLRCRRKTVLVLMCILTAYVLCWAPFYGF-TI 296
                             .||            |.|..:::.|.:|..::..:.:||.|.|.. |:
  Fly   388 ITTTTTTTVTLAKTSSPSIRVHDAALRRSNEAKTLESKKRVVKMLFVLVLEFFICWTPLYVINTM 452

Human   297 VRDFFPTVFVKEKHYL--TAFYVVECIAMSNSMIN--TVCFVTVKNNTMKYFKKMML-----LHW 352
            |....|.|:    .|:  ||...::.:|.|:|..|  |.||:...      |::..:     |.|
  Fly   453 VMLIGPVVY----EYVDYTAISFLQLLAYSSSCCNPITYCFMNAS------FRRAFVDTFKGLPW 507

Human   353 RPSQRGSKSS 362
            |   ||:.:|
  Fly   508 R---RGAGAS 514

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PROKR2NP_658986.1 7tm_4 66..>220 CDD:304433 50/160 (31%)
7tm_1 70..329 CDD:278431 80/370 (22%)
CCKLR-17D3NP_001097023.1 7tm_4 120..>244 CDD:304433 43/128 (34%)
7tm_1 128..487 CDD:278431 81/374 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.