DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PROKR2 and CCKLR-17D1

DIOPT Version :9

Sequence 1:NP_658986.1 Gene:PROKR2 / 128674 HGNCID:15836 Length:384 Species:Homo sapiens
Sequence 2:NP_001097021.1 Gene:CCKLR-17D1 / 32860 FlyBaseID:FBgn0259231 Length:673 Species:Drosophila melanogaster


Alignment Length:540 Identity:102/540 - (18%)
Similarity:182/540 - (33%) Gaps:206/540 - (38%)


- Green bases have known domain annotations that are detailed below.


Human    32 DYDLPMDEDEDMTKTRTFFAAKIVIGI-------------------ALAGIMLVCGIGNFVFIAA 77
            |.||.:|.|...|.:.:..|..:.:..                   ..:.|:|...:||.:.:..
  Fly   135 DLDLNLDMDLATTPSSSTLAPAVTVRTPGNRSVVRVSADVPIWVVPCYSAILLCAVVGNLLVVLT 199

Human    78 LTRYKKLRNLTNLLIANLAISDFLVAIICCPFEMDYYVVRQLSWEHGHVLCASVNYLRTVSLYVS 142
            |.:.:::|.:||:.:.||||||.|:.:.|.|..:...::|...:  |.:||..:.:.:..|:.||
  Fly   200 LVQNRRMRTITNVFLLNLAISDILLGVFCMPVTLVGTLLRHFIF--GELLCKLIQFAQAASVAVS 262

Human   143 TNALLAIAIDRYLAIVHPLKPRMNYQT---ASFLIALVWMVSILIAIPSAYFATETVLFIVKSQE 204
            :..|:||:.:||.||.|||:.| .:||   |:.:||::|:.|::...|.|.|:.   |.......
  Fly   263 SWTLVAISCERYYAICHPLRSR-TWQTINHANKIIAIIWLGSLVCMTPIAAFSQ---LMPTSRPG 323

Human   205 KIFCGQIWPVDQQLYYKSYFLFIFGVEFVGPVVTMTLCYARISRELWFK---------------- 253
            ...|.:.||.|...|.::|.||:.....|.|::.::..|..|:|.|:..                
  Fly   324 LRKCREQWPADSLNYERAYNLFLDLALLVLPLLALSFTYLFITRTLYVSMRNERAMNFGSSGPEV 388

Human   254 ----------------------------------------------------------------- 253
                                                                             
  Fly   389 TTSSSAAVAEAGSQRRANGSHCQSLDTIVPHQHNPHQQHHHHSQYYYDYGHCGSKRRLISGGGPC 453

Human   254 ------------AVPGFQTEQIR------------------------------------------ 264
                        :|...:.:||.                                          
  Fly   454 EGRRHLYCMRSASVKSLRHQQINGGGGTLSGTGAGNGECCSRVHRMRQQMQLQQQGYVSDNESRR 518

Human   265 ---------------------KRLRCRRKTVLVLMCILTAYVLCWAPFYGF-TIVRDFFPTVFVK 307
                                 |.|..:::.|.:|..::..:.:||.|.|.. |:.....|||:  
  Fly   519 KSLSQPSLRITEAGLRRSNETKSLESKKRVVKMLFVLVLEFFICWTPLYVINTMTMLLGPTVY-- 581

Human   308 EKHYL--TAFYVVECIAMSNSMIN--TVCFV--TVKNNTMKYFKKMMLLH--------WRPSQRG 358
              .|:  |:...::.:|.|:|..|  |.||:  :.:...:..||.|.:..        ||   |.
  Fly   582 --EYVGYTSISFLQLLAYSSSCCNPITYCFMNASFRRAFVDTFKGMRVCERLCAPCCFWR---RR 641

Human   359 SKSSADLDLRTNGVPTTEEV 378
            ||:..:|.:..|.:.....|
  Fly   642 SKNETNLSVAGNSIALANSV 661

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PROKR2NP_658986.1 7tm_4 66..>220 CDD:304433 48/156 (31%)
7tm_1 70..329 CDD:278431 78/420 (19%)
CCKLR-17D1NP_001097021.1 7tm_4 185..>308 CDD:304433 42/125 (34%)
7tm_1 192..>380 CDD:278431 58/193 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.