Sequence 1: | NP_658986.1 | Gene: | PROKR2 / 128674 | HGNCID: | 15836 | Length: | 384 | Species: | Homo sapiens |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_569971.3 | Gene: | CG4313 / 31169 | FlyBaseID: | FBgn0025632 | Length: | 541 | Species: | Drosophila melanogaster |
Alignment Length: | 200 | Identity: | 56/200 - (28%) |
---|---|---|---|
Similarity: | 93/200 - (46%) | Gaps: | 38/200 - (19%) |
- Green bases have known domain annotations that are detailed below.
Human 63 IMLVCGI-GNFVFIAALTRYKKLRNLTNLLIANLAISDFLVAIICCPFEMDYYVVRQLSWEHGHV 126
Human 127 LCASVNYLRTVSLYVSTNALLAIAIDRYLAIVHPLK-PRMNYQT--ASFLIALVWMVSILIAIPS 188
Human 189 AYFATETVLFIVKSQEKIFCGQIWPV---DQQL---------YYKSYFLFIFGVEFVGPVVTMTL 241
Human 242 CYARI 246 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
PROKR2 | NP_658986.1 | 7tm_4 | 66..>220 | CDD:304433 | 45/169 (27%) |
7tm_1 | 70..329 | CDD:278431 | 54/191 (28%) | ||
CG4313 | NP_569971.3 | 7tm_4 | 88..>197 | CDD:304433 | 37/111 (33%) |
7tm_1 | 94..>273 | CDD:278431 | 54/191 (28%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |