DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PROKR2 and CG4313

DIOPT Version :9

Sequence 1:NP_658986.1 Gene:PROKR2 / 128674 HGNCID:15836 Length:384 Species:Homo sapiens
Sequence 2:NP_569971.3 Gene:CG4313 / 31169 FlyBaseID:FBgn0025632 Length:541 Species:Drosophila melanogaster


Alignment Length:200 Identity:56/200 - (28%)
Similarity:93/200 - (46%) Gaps:38/200 - (19%)


- Green bases have known domain annotations that are detailed below.


Human    63 IMLVCGI-GNFVFIAALTRYKKLRNLTNLLIANLAISDFLVAIICCPFEMDYYVVRQLSWEHGHV 126
            :.::.|: ||.:.|.||:|.::.||.|.:.|.||:.||.|......|.....:  ::.:|.|..:
  Fly    86 VFIIVGVPGNLLTIVALSRGRQTRNSTAIFIINLSCSDLLFGCFNLPLAASTF--KERAWTHSDL 148

Human   127 LCASVNYLRTVSLYVSTNALLAIAIDRYLAIVHPLK-PRMNYQT--ASFLIALVWMVSILIAIPS 188
            ||.....||...|.||..::..|.|:||:.|.||.: ||: ||.  .:.::|..|:.:..|.||:
  Fly   149 LCRLFPMLRYGLLAVSLLSVSLITINRYIIIAHPRQYPRI-YQRRYLALMVAGTWITTFSIMIPT 212

Human   189 AYFATETVLFIVKSQEKIFCGQIWPV---DQQL---------YYKSYFLFIFGVEFVGPVVTMTL 241
                              :.| :|.:   |..:         |.:|...|:|...|:.|.:.:.:
  Fly   213 ------------------WRG-VWGIFGLDVSIGSCSIMHDRYGRSPKEFLFIAAFMVPCICIVI 258

Human   242 CYARI 246
            |||||
  Fly   259 CYARI 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PROKR2NP_658986.1 7tm_4 66..>220 CDD:304433 45/169 (27%)
7tm_1 70..329 CDD:278431 54/191 (28%)
CG4313NP_569971.3 7tm_4 88..>197 CDD:304433 37/111 (33%)
7tm_1 94..>273 CDD:278431 54/191 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.