| Sequence 1: | NP_658986.1 | Gene: | PROKR2 / 128674 | HGNCID: | 15836 | Length: | 384 | Species: | Homo sapiens |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001256126.1 | Gene: | dop-2 / 179347 | WormBaseID: | WBGene00001053 | Length: | 849 | Species: | Caenorhabditis elegans |
| Alignment Length: | 207 | Identity: | 58/207 - (28%) |
|---|---|---|---|
| Similarity: | 96/207 - (46%) | Gaps: | 44/207 - (21%) |
- Green bases have known domain annotations that are detailed below.
|
Human 57 GIALAGIMLVCGIGNFVFIAALTRYKKLRNLTNLLIANLAISDFLVAIICCPFEMDYYVVRQLSW 121
Human 122 EHGHVLCASVNYLRTVSLYV------STNALLAIAI---DRYLAIVHPL---KPRMNYQTASFLI 174
Human 175 ALVWMVSILIAIPSAYFATETVLFIVKSQEKIFCGQIWPVDQQLY----YKSYFLFIFG-VEFVG 234
Human 235 PVVTMTLCYARI 246 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| PROKR2 | NP_658986.1 | 7tm_4 | 66..>220 | CDD:304433 | 46/169 (27%) |
| 7tm_1 | 70..329 | CDD:278431 | 54/194 (28%) | ||
| dop-2 | NP_001256126.1 | 7tmA_D2-like_dopamine_R | 38..>233 | CDD:320181 | 58/207 (28%) |
| TM helix 1 | 40..64 | CDD:320181 | 7/22 (32%) | ||
| TM helix 2 | 73..95 | CDD:320181 | 12/21 (57%) | ||
| TM helix 3 | 112..134 | CDD:320181 | 5/21 (24%) | ||
| TM helix 4 | 158..174 | CDD:320181 | 8/32 (25%) | ||
| TM helix 5 | 195..218 | CDD:320181 | 4/22 (18%) | ||
| 7tm_GPCRs | <745..828 | CDD:421689 | |||
| TM helix 6 | 751..781 | CDD:410628 | |||
| TM helix 7 | 796..821 | CDD:410628 | |||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 1 | 1.000 | - | - | ||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 2 | 1.910 | |||||