DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment SIRPD and him-4

DIOPT Version :9

Sequence 1:	NP_848555.2	Gene:	SIRPD / 128646	HGNCID:	16248	Length:	197	Species:	Homo sapiens
Sequence 2:	NP_001024582.1	Gene:	him-4 / 181187	WormBaseID:	WBGene00001863	Length:	5198	Species:	Caenorhabditis elegans

Alignment Length:	133	Identity:	28/133 - (21%)
Similarity:	48/133 - (36%)	Gaps:	31/133 - (23%)

- Green bases have known domain annotations that are detailed below.

Human    23 LAGVTHVFHVQQTEMSQTVSTGESIILSCSVPNTLPNGPVLWFKGTGPNRKLIYNFKQGNFPRVK 87
            |..||...|.::.........|::::|:|:..:::|...|.|               ..:...|:
Worm  2754 LVRVTAPPHFEKEREEVVARVGDTMLLTCNAESSVPLSSVYW---------------HAHDESVQ 2803

Human    88 EIGDTTKPGNTDFSTRIREISLADAGTYYCV---------KFIKGRAIKEYQSGRGTQVFVTEQN 143
            ....|:|....:.:..:..|.|.|.|.|||.         ||.|...|:       |..|:.:|.
Worm  2804 NGVITSKYAANEKTLNVTNIQLDDEGFYYCTAVNEAGITKKFFKLIVIE-------TPYFLDQQK 2861

Human   144 PRP 146
            ..|
Worm  2862 LYP 2864

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
SIRPD	NP_848555.2	V-set	34..140	CDD:284989	22/114 (19%)
		IG_like	38..118	CDD:214653	15/79 (19%)
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	139..158		2/8 (25%)
him-4	NP_001024582.1	IG_like	442..515	CDD:214653
		IG	527..605	CDD:214652
		Ig	628..694	CDD:319273
		I-set	702..789	CDD:369462
		I-set	793..881	CDD:369462
		Ig	899..974	CDD:386229
		I-set	1012..1081	CDD:369462
		Ig	1109..1172	CDD:319273
		Ig	1196..1263	CDD:319273
		IG_like	1277..1358	CDD:214653
		I-set	1373..1450	CDD:369462
		Ig	1474..1544	CDD:386229
		IGc2	1563..1628	CDD:197706
		Ig	1651..1732	CDD:386229
		Ig	1755..1818	CDD:319273
		Ig	1839..1912	CDD:386229
		Ig	1930..2002	CDD:386229
		IG_like	2014..2095	CDD:214653
		Ig	2094..2182	CDD:386229
		Ig	2190..2283	CDD:386229
		I-set	2296..2380	CDD:369462
		Ig	2384..2471	CDD:386229
		IGc2	2492..2556	CDD:197706
		Ig	2580..2654	CDD:386229
		Ig	2686..2753	CDD:319273
		IG_like	2768..2850	CDD:214653	19/96 (20%)
		I-set	2854..2939	CDD:369462	3/11 (27%)
		IG_like	2951..3031	CDD:214653
		I-set	3046..3116	CDD:369462
		I-set	3127..3213	CDD:369462
		Ig	3217..3292	CDD:386229
		I-set	3300..3386	CDD:369462
		I-set	3396..3472	CDD:369462
		I-set	3481..3569	CDD:369462
		I-set	3591..3663	CDD:369462
		Ig	3667..3762	CDD:386229
		Ig	3775..3848	CDD:386229
		Ig	3859..3947	CDD:386229
		IGc2	3968..4031	CDD:197706
		Ig_3	4045..4119	CDD:372822
		Ig_3	4136..4210	CDD:372822
		Ig	<4262..4314	CDD:386229
		Ig	4318..4406	CDD:386229
		IG_like	4418..4496	CDD:214653
		I-set	4570..4654	CDD:369462
		I-set	4752..4836	CDD:369462
		EGF_CA	4996..5027	CDD:238011
		EGF_CA	5034..5076	CDD:214542
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	0.910