DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment BHLHE23 and nau

DIOPT Version :9

Sequence 1:NP_542173.2 Gene:BHLHE23 / 128408 HGNCID:16093 Length:241 Species:Homo sapiens
Sequence 2:NP_476650.1 Gene:nau / 42799 FlyBaseID:FBgn0002922 Length:332 Species:Drosophila melanogaster


Alignment Length:110 Identity:27/110 - (24%)
Similarity:52/110 - (47%) Gaps:14/110 - (12%)


- Green bases have known domain annotations that are detailed below.


Human   118 RLSINARERRRMHDLNDALDGLRAVIPYAHSPSVRKLSKIATLLLAKNYILMQAQALDEMRRLVA 182
            |.:...|||||:..:|:|.:.|:.  ..:.:|: ::|.|:..|..|..||    ::|:::.:..:
  Fly   163 RKAATMRERRRLRKVNEAFEILKR--RTSSNPN-QRLPKVEILRNAIEYI----ESLEDLLQESS 220

Human   183 FLNQGQGLAAPVNAAPLTPFGQATVCPFSAGAALGPCPDKCAAFS 227
            ....|..||..::....    |:......|||.|   .||.:.::
  Fly   221 TTRDGDNLAPSLSGKSC----QSDYLSSYAGAYL---EDKLSFYN 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
BHLHE23NP_542173.2 bHLH_SF 111..191 CDD:412148 18/72 (25%)
nauNP_476650.1 Basic 89..166 CDD:299793 1/2 (50%)
HLH 162..213 CDD:278439 16/56 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.