DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AgaP_AGAP002028 and DMA1

DIOPT Version :9

Sequence 1:XP_321026.4 Gene:AgaP_AGAP002028 / 1281089 VectorBaseID:AGAP002028 Length:615 Species:Anopheles gambiae
Sequence 2:NP_011983.1 Gene:DMA1 / 856515 SGDID:S000001157 Length:416 Species:Saccharomyces cerevisiae


Alignment Length:125 Identity:27/125 - (21%)
Similarity:48/125 - (38%) Gaps:30/125 - (24%)


- Green bases have known domain annotations that are detailed below.


Mosquito   221 IIRCIRER-RRRMRHRLPARVLRK------IGIVKFAKGMRFDTCAICLEDFVENERLRVLPCRH 278
            |.||::.: ......:|.|....|      ..:.|...|:..:.|:|||......:.:.:.||.|
Yeast   283 IYRCVKMKIELNKSWKLKANAFNKEALSRIKNLQKLTTGLEQEDCSICLNKIKPCQAIFISPCAH 347

Mosquito   279 AYHAICIDPWLTKN--RRVCPICKRRVIVRGEARQRRYSSDSMSSTNADESTPLLNSTEN 336
            ::|..|:...:..|  :.:||.|:                     ||.|..|.|.:.:|:
Yeast   348 SWHFHCVRRLVIMNYPQFMCPNCR---------------------TNCDLETTLESESES 386

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AgaP_AGAP002028XP_321026.4 PA_C_RZF_like 51..197 CDD:239038
zf-RING_2 256..300 CDD:290367 12/45 (27%)
DMA1NP_011983.1 FHA 121..308 CDD:224630 6/24 (25%)
RING-H2_Dmap_like 325..371 CDD:319372 12/45 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X670
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.