DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AgaP_AGAP002028 and ASR1

DIOPT Version :9

Sequence 1:XP_321026.4 Gene:AgaP_AGAP002028 / 1281089 VectorBaseID:AGAP002028 Length:615 Species:Anopheles gambiae
Sequence 2:NP_015418.2 Gene:ASR1 / 856208 SGDID:S000006297 Length:288 Species:Saccharomyces cerevisiae


Alignment Length:47 Identity:18/47 - (38%)
Similarity:24/47 - (51%) Gaps:2/47 - (4%)


- Green bases have known domain annotations that are detailed below.


Mosquito   256 DTCAICLEDFVENERLRVL-PCRHAYHAICIDPWLTKNRRV-CPICK 300
            :.|.|||.|..|.|:...| .|.|.:|..||..|...:..: ||||:
Yeast     2 EECPICLADDQEGEQFGCLNVCGHKFHLNCIREWHKYSINLKCPICR 48

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AgaP_AGAP002028XP_321026.4 PA_C_RZF_like 51..197 CDD:239038
zf-RING_2 256..300 CDD:290367 17/45 (38%)
ASR1NP_015418.2 RING-H2 4..48 CDD:319362 17/43 (40%)
PHD 121..167 CDD:214584
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.