powered by:
Protein Alignment AgaP_AGAP002028 and ASR1
DIOPT Version :9
Sequence 1: | XP_321026.4 |
Gene: | AgaP_AGAP002028 / 1281089 |
VectorBaseID: | AGAP002028 |
Length: | 615 |
Species: | Anopheles gambiae |
Sequence 2: | NP_015418.2 |
Gene: | ASR1 / 856208 |
SGDID: | S000006297 |
Length: | 288 |
Species: | Saccharomyces cerevisiae |
Alignment Length: | 47 |
Identity: | 18/47 - (38%) |
Similarity: | 24/47 - (51%) |
Gaps: | 2/47 - (4%) |
- Green bases have known domain annotations that are detailed below.
Mosquito 256 DTCAICLEDFVENERLRVL-PCRHAYHAICIDPWLTKNRRV-CPICK 300
:.|.|||.|..|.|:...| .|.|.:|..||..|...:..: ||||:
Yeast 2 EECPICLADDQEGEQFGCLNVCGHKFHLNCIREWHKYSINLKCPICR 48
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.910 |
|
Return to query results.
Submit another query.