DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment AgaP_AGAP002028 and ASR1

DIOPT Version :9

Sequence 1:	XP_321026.4	Gene:	AgaP_AGAP002028 / 1281089	VectorBaseID:	AGAP002028	Length:	615	Species:	Anopheles gambiae
Sequence 2:	NP_015418.2	Gene:	ASR1 / 856208	SGDID:	S000006297	Length:	288	Species:	Saccharomyces cerevisiae

Alignment Length:	47	Identity:	18/47 - (38%)
Similarity:	24/47 - (51%)	Gaps:	2/47 - (4%)

- Green bases have known domain annotations that are detailed below.

Mosquito   256 DTCAICLEDFVENERLRVL-PCRHAYHAICIDPWLTKNRRV-CPICK 300
            :.|.|||.|..|.|:...| .|.|.:|..||..|...:..: ||||:
Yeast     2 EECPICLADDQEGEQFGCLNVCGHKFHLNCIREWHKYSINLKCPICR 48

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
AgaP_AGAP002028	XP_321026.4	PA_C_RZF_like	51..197	CDD:239038
AgaP_AGAP002028	XP_321026.4	zf-RING_2	256..300	CDD:290367	17/45 (38%)
ASR1	NP_015418.2	RING-H2	4..48	CDD:319362	17/43 (40%)
ASR1	NP_015418.2	PHD	121..167	CDD:214584
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
SonicParanoid	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	0.910