DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AgaP_AGAP002028 and HRD1

DIOPT Version :9

Sequence 1:XP_321026.4 Gene:AgaP_AGAP002028 / 1281089 VectorBaseID:AGAP002028 Length:615 Species:Anopheles gambiae
Sequence 2:NP_014630.1 Gene:HRD1 / 854149 SGDID:S000005373 Length:551 Species:Saccharomyces cerevisiae


Alignment Length:137 Identity:36/137 - (26%)
Similarity:64/137 - (46%) Gaps:22/137 - (16%)


- Green bases have known domain annotations that are detailed below.


Mosquito   258 CAICLEDFV----------ENERLRVLPCRHAYHAICIDPWLTKNRRVCPICKRRVI-VRGEARQ 311
            |.||:::.:          :|::.:.|||.|..|..|:..|:.:: :.||||:..|. .:|...|
Yeast   349 CIICMDELIHSPNQQTWKNKNKKPKRLPCGHILHLSCLKNWMERS-QTCPICRLPVFDEKGNVVQ 412

Mosquito   312 RRYSSDSMSSTNADESTPLLNSTENST--SGSAAGVVTAPPATSSSSPVTAAVAPSGNSGAGA-Q 373
            ..::|:|..:|    .|.:.:||..:|  .|.|..|...|..|:|..   ..:.|:.|....| :
Yeast   413 TTFTSNSDITT----QTTVTDSTGIATDQQGFANEVDLLPTRTTSPD---IRIVPTQNIDTLAMR 470

Mosquito   374 TAAAAAP 380
            |.:.:.|
Yeast   471 TRSTSTP 477

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AgaP_AGAP002028XP_321026.4 PA_C_RZF_like 51..197 CDD:239038
zf-RING_2 256..300 CDD:290367 14/51 (27%)
HRD1NP_014630.1 HRD1 5..551 CDD:227568 36/137 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.