DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment AgaP_AGAP002028 and HRT1

DIOPT Version :9

Sequence 1:	XP_321026.4	Gene:	AgaP_AGAP002028 / 1281089	VectorBaseID:	AGAP002028	Length:	615	Species:	Anopheles gambiae
Sequence 2:	NP_014508.1	Gene:	HRT1 / 853986	SGDID:	S000005493	Length:	121	Species:	Saccharomyces cerevisiae

Alignment Length:	58	Identity:	19/58 - (32%)
Similarity:	25/58 - (43%)	Gaps:	16/58 - (27%)

- Green bases have known domain annotations that are detailed below.

Mosquito   256 DTCAICLEDFVE--------------NERLRVL-PCRHAYHAICIDPWLTKNRRVCPI 298
            |.||||....:|              ||.:... .|.||:|..||:.|: |.|..||:
Yeast    53 DNCAICRNHIMEPCIECQPKAMTDTDNECVAAWGVCNHAFHLHCINKWI-KTRDACPL 109

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
AgaP_AGAP002028	XP_321026.4	PA_C_RZF_like	51..197	CDD:239038
AgaP_AGAP002028	XP_321026.4	zf-RING_2	256..300	CDD:290367	19/58 (33%)
HRT1	NP_014508.1	APC11	33..121	CDD:227521	19/58 (33%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
SonicParanoid	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	0.910