DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AgaP_AGAP002028 and SPAC57A7.09

DIOPT Version :9

Sequence 1:XP_321026.4 Gene:AgaP_AGAP002028 / 1281089 VectorBaseID:AGAP002028 Length:615 Species:Anopheles gambiae
Sequence 2:NP_593372.1 Gene:SPAC57A7.09 / 2542187 PomBaseID:SPAC57A7.09 Length:372 Species:Schizosaccharomyces pombe


Alignment Length:231 Identity:58/231 - (25%)
Similarity:96/231 - (41%) Gaps:51/231 - (22%)


- Green bases have known domain annotations that are detailed below.


Mosquito   115 VVIARYNCSFEVKVRNAQQAGYAMVIV---HNVGSNDLEHMSANHPQD---LLIPSVFVGESAGR 173
            :::.|..|::..|...||:.|:..|||   .:..|..|.:|.|....|   :.|||:||..|:..
pombe   145 LLVQRGKCTYFDKALEAQRLGFKGVIVGDNRSPSSFRLHYMVAPDKVDESKVHIPSLFVSTSSYN 209

Mosquito   174 SIIEAYLYDHDYALVI---TDDIPFNISNNLIIPFAIVVGLCF---IIMVLFMIIRCIRE----- 227
            .:....|:.:...|.:   .:::     .::..||.    |||   |||::.:....||:     
pombe   210 LLWSDLLHSYRQPLKLYAKPEEL-----GDMFWPFL----LCFSPSIIMLITVQALAIRKFIRTY 265

Mosquito   228 ----RRRRMRHRLPARVLRKIGIVKFAKGMRFDT---------------------CAICLEDFVE 267
                :.||....||:|.:.:.|.....:.:...|                     |.||||.|.:
pombe   266 RTKSKTRRFIEDLPSRTISREGFYSEEEEIENSTQNGELVPLMDESTRRATFGVECVICLESFTK 330

Mosquito   268 NERLRVLPCRHAYHAICIDPWLTKNRRVCPICKRRV 303
            .:::..|||:|.:|..||..|:...|..||.|...|
pombe   331 GDKVVALPCKHEFHRPCIAKWIVDYRHACPTCNTEV 366

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AgaP_AGAP002028XP_321026.4 PA_C_RZF_like 51..197 CDD:239038 22/90 (24%)
zf-RING_2 256..300 CDD:290367 18/64 (28%)
SPAC57A7.09NP_593372.1 COG5540 1..369 CDD:227827 58/231 (25%)
Peptidases_S8_S53 <144..211 CDD:299169 20/65 (31%)
zf-RING_2 320..362 CDD:290367 17/41 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4628
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm71701
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X670
TreeFam 00.000 Not matched by this tool.
54.810

Return to query results.
Submit another query.