DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cntn1 and Nrg

DIOPT Version :9

Sequence 1:NP_001153119.1 Gene:Cntn1 / 12805 MGIID:105980 Length:1020 Species:Mus musculus
Sequence 2:NP_001245581.1 Gene:Nrg / 31792 FlyBaseID:FBgn0264975 Length:1309 Species:Drosophila melanogaster


Alignment Length:1065 Identity:286/1065 - (26%)
Similarity:444/1065 - (41%) Gaps:148/1065 - (13%)


- Green bases have known domain annotations that are detailed below.


Mouse    11 LLISLTSCLGDFTWHRRYGHGVSEEDKG-FGPIFEEQPINTIYPEESL-----EGKVS-----LN 64
            ||::|. |.|            |.|.|| ..|...:||.    |.|.|     :.|.|     :.
  Fly    11 LLVALL-CAG------------SAESKGNRPPRITKQPA----PGELLFKVAQQNKESDNPFIIE 58

Mouse    65 CRARASPFPVYKWRMNNGDVD---LTNDRYSMVG-GNLVINNPDKQKDAGVYYCLASNNYGMVRS 125
            |.|...|.|.|.|..|....|   ..|......| |.|||..| |.:|.|.|.|.|||.:|...|
  Fly    59 CEADGQPEPEYSWIKNGKKFDWQAYDNRMLRQPGRGTLVITIP-KDEDRGHYQCFASNEFGTATS 122

Mouse   126 TEATLSFGYLDPFPPEERPEVKVKEGKGMVLLCDPPYHFPDDLSYRWLLNEF--PVFITMDKRRF 188
            ....:....|:.|..|....::..||:..:|.|..|..||.. :..|::.|.  ....:::..|.
  Fly   123 NSVYVRKAELNAFKDEAAKTLEAVEGEPFMLKCAAPDGFPSP-TVNWMIQESIDGSIKSINNSRM 186

Mouse   189 VSQTNGNLYIANVESSDRGN---YSCFVSSPSITKSVF---SKF---IPLIPIPERTTKPYPADI 244
            .....|||:.:||...|..:   |:|  |:.|:.:|.:   :|.   :..:.:.....|..|...
  Fly   187 TLDPEGNLWFSNVTREDASSDFYYAC--SATSVFRSEYKIGNKVLLDVKQMGVSASQNKHPPVRQ 249

Mouse   245 VVQFKDIYTMMGQNVTLECFALGNPVPDIRWRKVLEPMPSTAEISTS--GAVLKIFNIQLEDEGL 307
            .|..:....:.|:.:.|.|...|.|:|...|.|..:.:..:..|:..  |..|.|.....:|.|.
  Fly   250 YVSRRQSLALRGKRMELFCIYGGTPLPQTVWSKDGQRIQWSDRITQGHYGKSLVIRQTNFDDAGT 314

Mouse   308 YECEAENIRGKDKHQARI-------YVQAFPEWVEHINDTEVDIGSDLYWPCIATGKPIPTIRWL 365
            |.|:..|..|..:..:.|       |....||......|.||      .:.|.|.|.|.|.|.|:
  Fly   315 YTCDVSNGVGNAQSFSIILNVNSVPYFTKEPEIATAAEDEEV------VFECRAAGVPEPKISWI 373

Mouse   366 KNGYSYHK-----------GELRLYDVTFENAGMYQCIAENAYGSIYANAELKILALAPTFEMNP 419
            .||....:           ..:|:.::...:.|.|.|.|.|:.|.:|.:..|.:.|..||....|
  Fly   374 HNGKPIEQSTPNPRRTVTDNTIRIINLVKGDTGNYGCNATNSLGYVYKDVYLNVQAEPPTISEAP 438

Mouse   420 MKKKILAAKGGRVIIECKPKAAPKPKFSWSKGTEWLVNSSRILIWEDGSLEINNITRNDGGIYTC 484
              ..:....|..|.|:|:...:|||...|.:.:.|| ...|..:..:|.|||.::|.:|.|.|||
  Fly   439 --AAVSTVDGRNVTIKCRVNGSPKPLVKWLRASNWL-TGGRYNVQANGDLEIQDVTFSDAGKYTC 500

Mouse   485 FAENNRGKANSTGTLVITNPTRIILAPINADITVGENATMQCAASFDPALDLTFVWSFNGYVIDF 549
            :|:|..|:..:.|:||:...|||...|.|.::..|::||.:|..:.|..|::...|..:|..|||
  Fly   501 YAQNKFGEIQADGSLVVKEHTRITQEPQNYEVAAGQSATFRCNEAHDDTLEIEIDWWKDGQSIDF 565

Mouse   550 NKEITHIHYQRNFMLDANGELLIRNAQLKHAGRYTCTAQTIVDNSSASADLVVRGPPGPPGGLRI 614
            ..       |..|:...:..|.|.......:|.|||.|:|.:|.::|.|:|:|:..|..|   ::
  Fly   566 EA-------QPRFVKTNDNSLTIAKTMELDSGEYTCVARTRLDEATARANLIVQDVPNAP---KL 620

Mouse   615 EDI--RATSVALTWSRGSDNHSPISKYTIQTKTILSD-DWKDAKTDPPIIEGNMESAKAVDLIPW 676
            ..|  :|....:.|.:..||.|||..||||..|..:. .|..|....|    |.:|:..|.:.||
  Fly   621 TGITCQADKAEIHWEQQGDNRSPILHYTIQFNTSFTPASWDAAYEKVP----NTDSSFVVQMSPW 681

Mouse   677 MEYEFRVVATNTLGTGEPSIPSNRIKTDGAAPNVAPSDVGGGGGTNRELTITWAPLSREYHYGNN 741
            ..|.|||:|.|.:|...||..|:...|....|...|.:|.|.|.....|.|:|.|:....|...|
  Fly   682 ANYTFRVIAFNKIGASPPSAHSDSCTTQPDVPFKNPDNVVGQGTEPNNLVISWTPMPEIEHNAPN 746

Mouse   742 FGYIVAFKP------------FDGEEWKKVTVTNPDTGRYVHKDETMTPSTAFQVKVKAFNNKGD 794
            |.|.|::|.            ||   |::..:...|...:|          .:.:||.|.|::|:
  Fly   747 FHYYVSWKRDIPAAAWENNNIFD---WRQNNIVIADQPTFV----------KYLIKVVAINDRGE 798

Mouse   795 GPYSLVAVIN-SAQDAPSEAPTEVGVKVLSSSEIS-VHWKHVLEKIV----ESYQIRYWAGHDKE 853
            ...:...|:. |.:|.|.:|||...::.::||... :.|..|.|:.|    :.|:|:.|..::.|
  Fly   799 SNVAAEEVVGYSGEDRPLDAPTNFTMRQITSSTSGYMAWTPVSEESVRGHFKGYKIQTWTENEGE 863

Mouse   854 AAAHRVQVTSQEYSARLENLLPDTQYFIEVGACNSAGCGPSSDVIETFTRKAPPSQPPRIISSVR 918
            .....:.|....::|.:....||::.:..:.|.|....||.|.||:..|.:..||....:.:...
  Fly   864 EGLREIHVKGDTHNALVTQFKPDSKNYARILAYNGRFNGPPSAVIDFDTPEGVPSPVQGLDAYPL 928

Mouse   919 SGSRYIITWDHVVALSNESTVTGYKILYRPDGQHDGKLFSTHKHSIEVPIPRDGEYVVEVRAHSD 983
            ..|.:::.|..  .|.....:|||||.|.                 ||    ...||.|.|.:..
  Fly   929 GSSAFMLHWKK--PLYPNGKLTGYKIYYE-----------------EV----KESYVGERREYDP 970

Mouse   984 G-GDGVVSQVKISGVSTLSSSLLSL 1007
            . .|..|:::|::|:...|...:|:
  Fly   971 HITDPRVTRMKMAGLKPNSKYRISI 995

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cntn1NP_001153119.1 IgI_1_Contactin-1 40..134 CDD:409436 33/107 (31%)
Ig strand B 61..65 CDD:409436 1/8 (13%)
Ig strand C 74..78 CDD:409436 1/3 (33%)
Ig strand E 96..100 CDD:409436 2/3 (67%)
Ig strand F 111..116 CDD:409436 2/4 (50%)
Ig strand G 125..128 CDD:409436 1/2 (50%)
Ig2_Contactin-2-like 142..230 CDD:409392 22/98 (22%)
Ig strand B 154..158 CDD:409392 1/3 (33%)
Ig strand C 169..173 CDD:409392 0/3 (0%)
Ig strand E 194..198 CDD:409392 3/3 (100%)
Ig strand F 208..213 CDD:409392 2/7 (29%)
Ig strand G 224..227 CDD:409392 1/5 (20%)
IgI_3_Contactin-1 241..328 CDD:143259 22/95 (23%)
Ig strand B 259..263 CDD:143259 1/3 (33%)
Ig strand C 272..276 CDD:143259 0/3 (0%)
Ig strand E 293..297 CDD:143259 1/3 (33%)
Ig strand F 307..312 CDD:143259 2/4 (50%)
Ig strand G 320..323 CDD:143259 0/2 (0%)
Ig 332..408 CDD:416386 22/86 (26%)
Ig strand A 332..335 CDD:409353 1/2 (50%)
Ig strand A' 339..343 CDD:409353 2/3 (67%)
Ig strand B 347..355 CDD:409353 1/7 (14%)
Ig strand C 361..366 CDD:409353 2/4 (50%)
Ig strand C' 368..371 CDD:409353 1/2 (50%)
Ig strand E 374..379 CDD:409353 1/4 (25%)
Ig strand F 388..395 CDD:409353 3/6 (50%)
Ig strand G 399..408 CDD:409353 2/8 (25%)
Ig5_Contactin-1 413..501 CDD:409438 29/87 (33%)
Ig strand B 432..436 CDD:409438 2/3 (67%)
Ig strand C 445..449 CDD:409438 0/3 (0%)
Ig strand E 467..471 CDD:409438 2/3 (67%)
Ig strand F 481..486 CDD:409438 3/4 (75%)
Ig strand G 494..497 CDD:409438 0/2 (0%)
Ig6_Contactin 503..603 CDD:409359 30/99 (30%)
Ig strand B 522..526 CDD:409359 2/3 (67%)
Ig strand C 537..541 CDD:409359 0/3 (0%)
Ig strand E 568..572 CDD:409359 1/3 (33%)
Ig strand F 582..587 CDD:409359 3/4 (75%)
Ig strand G 595..598 CDD:409359 1/2 (50%)
FN3 612..699 CDD:238020 30/89 (34%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 695..719 7/23 (30%)
FN3 711..803 CDD:238020 24/103 (23%)
fn3 813..895 CDD:394996 21/86 (24%)
FN3 907..991 CDD:238020 19/84 (23%)
NrgNP_001245581.1 Ig 55..128 CDD:299845 25/73 (34%)
IG_like 57..127 CDD:214653 25/70 (36%)
Ig 135..214 CDD:299845 20/81 (25%)
IG_like 141..216 CDD:214653 19/77 (25%)
ig 251..332 CDD:278476 19/80 (24%)
I-set 339..427 CDD:254352 24/93 (26%)
Ig 354..427 CDD:299845 20/78 (26%)
I-set 432..517 CDD:254352 29/87 (33%)
Ig 446..517 CDD:299845 26/71 (37%)
I-set 522..611 CDD:254352 29/95 (31%)
ig 525..609 CDD:278476 26/90 (29%)
FN3 613..707 CDD:238020 33/100 (33%)
FN3 716..807 CDD:238020 24/103 (23%)
fn3 817..905 CDD:278470 21/87 (24%)
FN3 917..1004 CDD:238020 23/102 (23%)
FN3 1041..1111 CDD:238020
Bravo_FIGEY 1155..>1221 CDD:290593
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3513
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.