DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43055 and lectin-24Db

DIOPT Version :10

Sequence 1:NP_001245867.1 Gene:CG43055 / 12798556 FlyBaseID:FBgn0262357 Length:180 Species:Drosophila melanogaster
Sequence 2:NP_652641.1 Gene:lectin-24Db / 53550 FlyBaseID:FBgn0040102 Length:359 Species:Drosophila melanogaster


Alignment Length:127 Identity:37/127 - (29%)
Similarity:60/127 - (47%) Gaps:10/127 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 FVKIGDSYYFIENKLDRNWYDAFEACRQMNADLVAFEDRKEQKLIYHYLVDNEMDTTYWTAGTDL 106
            |.:||...::|.:|...:|..|.:.||.|...:.|.:|::|...|...|.|.    :||....||
  Fly   238 FERIGSRLFYINHKDAYDWQSAVDFCRDMGGYIAAIKDQEELDAISARLDDK----SYWLGINDL 298

  Fly   107 AEQDSFVWFSNGQPVASDLWCNNEPNNAKNEEHCVEYKPLHPEAKMGLNDRVCTFKTGYICR 168
            ...:::|..::|:.|....|...|||:...:|:|||.      .:..:||..|..|...||:
  Fly   299 QSSNTYVSVASGREVEFLNWNAGEPNHGNEDENCVEL------IRSKMNDDPCHRKKHVICQ 354

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43055NP_001245867.1 CLECT 49..167 CDD:153057 32/117 (27%)
lectin-24DbNP_652641.1 IFT57 <64..215 CDD:463118
CLECT 247..354 CDD:153057 33/116 (28%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.