DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43055 and colec10

DIOPT Version :10

Sequence 1:NP_001245867.1 Gene:CG43055 / 12798556 FlyBaseID:FBgn0262357 Length:180 Species:Drosophila melanogaster
Sequence 2:NP_001011227.1 Gene:colec10 / 496663 XenbaseID:XB-GENE-945586 Length:275 Species:Xenopus tropicalis


Alignment Length:159 Identity:36/159 - (22%)
Similarity:63/159 - (39%) Gaps:18/159 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 CRAYQ-------ISTSVIEGVASYLNTPTAPFVKIGDSYYFIENKLDRNWYDAFEACRQMNADLV 75
            |..|:       ::.:.::....::....|...:..:.||:|..: :||:.||...||.....|.
 Frog   119 CGRYRKVVGQLDVNVAHLKSSLKFVKNVIAGIRETDEKYYYIVRE-ERNYRDALTQCRIRGGTLA 182

  Fly    76 AFEDRKEQKLIYHYLVDNEMDTTYWTAG-TDLAEQDSFVWFSNGQPVASDLWCNNEPNNAKNEEH 139
            ..:|:....||..|:  ::|.......| .|:.::..||:..|........|...|||:....|.
 Frog   183 MPKDQATNSLIADYI--SKMGLFRVFIGINDIEKEKQFVYADNSPLQTYSSWKAGEPNDGSGYED 245

  Fly   140 CVEYKPL-HPEAKMGLNDRVCTFKTGYIC 167
            |||.... |      .||..|:....::|
 Frog   246 CVEMLSTGH------WNDVDCSLTIYFVC 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43055NP_001245867.1 CLECT 49..167 CDD:153057 32/119 (27%)
colec10NP_001011227.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 39..76
gly_rich_SclB <45..>99 CDD:468478
CLECT_collectin_like 155..270 CDD:153061 33/123 (27%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.