DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43055 and nw

DIOPT Version :9

Sequence 1:NP_001245867.1 Gene:CG43055 / 12798556 FlyBaseID:FBgn0262357 Length:180 Species:Drosophila melanogaster
Sequence 2:NP_001027435.2 Gene:nw / 3772015 FlyBaseID:FBgn0283508 Length:491 Species:Drosophila melanogaster


Alignment Length:195 Identity:41/195 - (21%)
Similarity:77/195 - (39%) Gaps:54/195 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 KLTAFSAFLAIISLCRAYQISTSVIEGVASYLN--TPTAPFVKIGDSYYFIENKLDRNWYDAFEA 66
            |:..| ..|::::.....:|:|..::||..:::  .|.:|               :.|::.|::.
  Fly     3 KIVLF-CLLSLLACAAGQRITTIHLDGVQYFISRMNPYSP---------------ELNYFLAYQY 51

  Fly    67 CRQMNADLVAFEDRKEQKLIYHYLVD---NEMDTTYWTAGTDLAEQDSFVWFSNGQPVAS----- 123
            ||.:...|.:||.:::.:.:..||.:   ...|  :||:|..|. ...|:|.|.|.|..:     
  Fly    52 CRSLGLQLASFETKEKAESMTTYLKNAGYGNYD--FWTSGNRLG-TGMFLWMSTGLPFNATFDFF 113

  Fly   124 ---------------DLWCNNEP------NNAKNEEHCVEYKPLHPEAKMGLNDRVCTFKTGYIC 167
                           |...|..|      :::..|:.||..|  .|..|....|  |:....:||
  Fly   114 ENSADAIQAGLLDPVDHNSNTSPQRTARDSSSGAEKGCVILK--QPTLKWMPED--CSAVKDFIC 174

  Fly   168  167
              Fly   175  174

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43055NP_001245867.1 CLECT 49..167 CDD:153057 30/146 (21%)
nwNP_001027435.2 CLECT 31..176 CDD:153057 34/166 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1509611at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR22802
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.