DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43165 and WFDC8

DIOPT Version :10

Sequence 1:NP_001245858.1 Gene:CG43165 / 12798550 FlyBaseID:FBgn0262721 Length:95 Species:Drosophila melanogaster
Sequence 2:XP_016883608.1 Gene:WFDC8 / 90199 HGNCID:16163 Length:247 Species:Homo sapiens


Alignment Length:120 Identity:32/120 - (26%)
Similarity:40/120 - (33%) Gaps:47/120 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LLLALETV------------GLCLKDPI-CGQ--PPAVNGNDF--------------IKCAGSFE 44
            |.||||..            |||.|:.: |..  |.:.| .||              .||...|:
Human    29 LSLALEWTSAMLTKKIKHKPGLCPKERLTCTTELPDSCN-TDFDCKEYQKCCFFACQKKCMDPFQ 92

  Fly    45 KFSYYP--HINV---------------CQKFEYGGCFGNDNSFNTLEKCHKKCKL 82
            :....|  |.|.               |..|:|.||.||.|:|...:.|...|.|
Human    93 EPCMLPVRHGNCNHEAQRWHFDFKNYRCTPFKYRGCEGNANNFLNEDACRTACML 147

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43165NP_001245858.1 Kunitz-type 24..80 CDD:444694 21/89 (24%)
WFDC8XP_016883608.1 WAP 47..90 CDD:459672 11/43 (26%)
KU 93..145 CDD:197529 13/51 (25%)
WAP 150..190 CDD:459672
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.