DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43165 and Sfp23F

DIOPT Version :10

Sequence 1:NP_001245858.1 Gene:CG43165 / 12798550 FlyBaseID:FBgn0262721 Length:95 Species:Drosophila melanogaster
Sequence 2:NP_001162856.1 Gene:Sfp23F / 8674054 FlyBaseID:FBgn0259949 Length:78 Species:Drosophila melanogaster


Alignment Length:102 Identity:27/102 - (26%)
Similarity:36/102 - (35%) Gaps:44/102 - (43%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 DGLELLRNYLTDAFQCAYHPLHGLFEKLSNCFYSTYSCWKYTPHSILCEPAMNEWISIVSR---- 94
            ||.|..|.|        |:...|:|        .|:.|   |.|.  .:||    |.||.|    
  Fly   299 DGTEKTRMY--------YYLNDGIF--------GTFYC---TAHE--AQPA----IPIVERKTGA 338

  Fly    95 -------------IYTLVL-TVMFPAL-PKDSIMIED 116
                         :..|:| .||.|.| ..||::.|:
  Fly   339 KDFPTSVWGPTCDVMDLILPDVMLPELNVGDSVVFEN 375

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43165NP_001245858.1 Kunitz-type 24..80 CDD:444694 12/45 (27%)
Sfp23FNP_001162856.1 Kunitz-type 32..78 CDD:444694
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.