DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43165 and TFPI2

DIOPT Version :10

Sequence 1:NP_001245858.1 Gene:CG43165 / 12798550 FlyBaseID:FBgn0262721 Length:95 Species:Drosophila melanogaster
Sequence 2:NP_006519.1 Gene:TFPI2 / 7980 HGNCID:11761 Length:235 Species:Homo sapiens


Alignment Length:68 Identity:21/68 - (30%)
Similarity:30/68 - (44%) Gaps:8/68 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 VGLCLKDPI---CGQPPAVNGNDFIKCAGSFEKFSYYPHINVCQKFEYGGCFGNDNSFNTLEKCH 77
            :|.|....|   |..|     .|...|:.:..::.:.|....|..|.|.||.||||:|.:.|.|.
Human   146 MGFCAPKKIPSFCYSP-----KDEGLCSANVTRYYFNPRYRTCDAFTYTGCGGNDNNFVSREDCK 205

  Fly    78 KKC 80
            :.|
Human   206 RAC 208

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43165NP_001245858.1 Kunitz-type 24..80 CDD:444694 18/58 (31%)
TFPI2NP_006519.1 Kunitz_TFPI2_1-like 32..88 CDD:438659
Kunitz_BPTI 95..149 CDD:425421 1/2 (50%)
Kunitz_TFPI1_TFPI2_3-like 155..204 CDD:438658 16/53 (30%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.