DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43165 and spint1b

DIOPT Version :10

Sequence 1:NP_001245858.1 Gene:CG43165 / 12798550 FlyBaseID:FBgn0262721 Length:95 Species:Drosophila melanogaster
Sequence 2:NP_001104693.2 Gene:spint1b / 797346 ZFINID:ZDB-GENE-071218-1 Length:501 Species:Danio rerio


Alignment Length:56 Identity:23/56 - (41%)
Similarity:26/56 - (46%) Gaps:5/56 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 CGQPPAVNGNDFIKCAGSFEKFSYYPHINVCQKFEYGGCFGNDNSFNTLEKCHKKC 80
            |..|||..     .|...|..:.|.|....|..|.||||.||.|:|.|.:||.|.|
Zfish   365 CTDPPATG-----PCRAHFHHWYYDPLSKKCHPFTYGGCDGNRNNFETADKCMKNC 415

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43165NP_001245858.1 Kunitz-type 24..80 CDD:444694 22/54 (41%)
spint1bNP_001104693.2 None

Return to query results.
Submit another query.