DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43165 and Eppin

DIOPT Version :10

Sequence 1:NP_001245858.1 Gene:CG43165 / 12798550 FlyBaseID:FBgn0262721 Length:95 Species:Drosophila melanogaster
Sequence 2:NP_083601.1 Gene:Eppin / 75526 MGIID:1922776 Length:134 Species:Mus musculus


Alignment Length:65 Identity:21/65 - (32%)
Similarity:30/65 - (46%) Gaps:7/65 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 CL--KDPICGQPPAVNGNDFIKCAGSFEKFSYYPHINVCQKFEYGGCFGNDNSFNTLEKCHKKCK 81
            ||  :..||..|     .|...|...|.::.:....:.||.|.||||.||:|:|.:...|...|:
Mouse    69 CLNPQQDICSLP-----KDSGYCMAYFRRWWFNKENSTCQVFIYGGCQGNNNNFQSQSICQNACE 128

  Fly    82  81
            Mouse   129  128

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43165NP_001245858.1 Kunitz-type 24..80 CDD:444694 18/55 (33%)
EppinNP_083601.1 WAP 30..72 CDD:459672 2/2 (100%)
Kunitz_eppin 75..131 CDD:438654 19/59 (32%)
Interaction with SEMG1. /evidence=ECO:0000250 102..133 13/27 (48%)
Interaction with LTF. /evidence=ECO:0000250 117..133 3/12 (25%)

Return to query results.
Submit another query.