DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43165 and spint2

DIOPT Version :10

Sequence 1:NP_001245858.1 Gene:CG43165 / 12798550 FlyBaseID:FBgn0262721 Length:95 Species:Drosophila melanogaster
Sequence 2:NP_001039077.1 Gene:spint2 / 733874 XenbaseID:XB-GENE-947329 Length:394 Species:Xenopus tropicalis


Alignment Length:61 Identity:26/61 - (42%)
Similarity:32/61 - (52%) Gaps:6/61 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 LKDPICGQPPAVNGNDFIKCAGSFEKFSYYPHINVCQKFEYGGCFGNDNSFNTLEKCHKKC 80
            ||| .| .|.||.|    .|..:||::.|.|:...|:.|.||||.||.|:....|.|..||
 Frog   115 LKD-FC-LPEAVTG----PCRAAFERWWYNPNTQTCENFTYGGCKGNLNNHIGEEVCMNKC 169

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43165NP_001245858.1 Kunitz-type 24..80 CDD:444694 21/55 (38%)
spint2NP_001039077.1 MANEC 19..104 CDD:471454
Kunitz-type 117..169 CDD:444694 22/57 (39%)
Kunitz-type 195..246 CDD:444694
Kunitz-type 266..318 CDD:444694
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.