DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43165 and Wfdc6a

DIOPT Version :10

Sequence 1:NP_001245858.1 Gene:CG43165 / 12798550 FlyBaseID:FBgn0262721 Length:95 Species:Drosophila melanogaster
Sequence 2:NP_001233212.2 Gene:Wfdc6a / 685153 RGDID:1597730 Length:146 Species:Rattus norvegicus


Alignment Length:62 Identity:20/62 - (32%)
Similarity:28/62 - (45%) Gaps:5/62 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 LKDPICGQPPAVNGNDFIKCAGSFEKFSYYPHINVCQKFEYGGCFGNDNSFNTLEKCHKKCK 81
            |::.||..|     .|...|.....::.|.....:|.:|.||||.||.|:|.:...|...||
  Rat    82 LREDICSLP-----QDAGPCLAYLPRWWYNEDTGLCTQFIYGGCQGNPNNFQSEGICTVVCK 138

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43165NP_001245858.1 Kunitz-type 24..80 CDD:444694 17/55 (31%)
Wfdc6aNP_001233212.2 WAP 42..81 CDD:459672
Kunitz_eppin 85..141 CDD:438654 19/59 (32%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.