DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43165 and spint2

DIOPT Version :10

Sequence 1:NP_001245858.1 Gene:CG43165 / 12798550 FlyBaseID:FBgn0262721 Length:95 Species:Drosophila melanogaster
Sequence 2:NP_001070718.2 Gene:spint2 / 562009 ZFINID:ZDB-GENE-061013-323 Length:431 Species:Danio rerio


Alignment Length:54 Identity:24/54 - (44%)
Similarity:32/54 - (59%) Gaps:6/54 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 QPPAVNGNDFIKCAGSFEKFSYYPHINVCQKFEYGGCFGNDNSFNTLEKCHKKC 80
            |.|||.||    |..|.::| ||.: .|||:|.||||.||.|::.:.:.|...|
Zfish   229 QSPAVTGN----CRASIKRF-YYNN-GVCQQFIYGGCGGNKNNYESEDSCMTAC 276

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43165NP_001245858.1 Kunitz-type 24..80 CDD:444694 23/52 (44%)
spint2NP_001070718.2 MANEC <56..108 CDD:471454
Kunitz-type 133..183 CDD:438633
Kunitz-type 228..276 CDD:438633 23/52 (44%)
Kunitz-type 302..354 CDD:444694
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.