DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43165 and CG14298

DIOPT Version :10

Sequence 1:NP_001245858.1 Gene:CG43165 / 12798550 FlyBaseID:FBgn0262721 Length:95 Species:Drosophila melanogaster
Sequence 2:NP_650755.1 Gene:CG14298 / 42259 FlyBaseID:FBgn0038654 Length:111 Species:Drosophila melanogaster


Alignment Length:102 Identity:24/102 - (23%)
Similarity:37/102 - (36%) Gaps:24/102 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MRLVVLGCLLLALETVGLCLKDPICGQPPAVNGNDFIKCAGSFEKFSYYPHIN------------ 53
            :|..::|.|.:.|.|....::  ..|...:.:||..:........|:.|...|            
  Fly    10 LRATLVGLLSIILLTQTAHIE--AFGSGGSSSGNGAVVSCKELNNFNCYVGRNEGNFCSRKDQTK 72

  Fly    54 ----------VCQKFEYGGCFGNDNSFNTLEKCHKKC 80
                      ||:.|.|.||.||.|.|.:.|.|..:|
  Fly    73 VVTRWYFDKGVCKPFNYKGCNGNRNRFCSQESCDARC 109

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43165NP_001245858.1 Kunitz-type 24..80 CDD:444694 18/77 (23%)
CG14298NP_650755.1 Kunitz-type <74..109 CDD:438633 12/34 (35%)

Return to query results.
Submit another query.