DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43165 and ambp

DIOPT Version :10

Sequence 1:NP_001245858.1 Gene:CG43165 / 12798550 FlyBaseID:FBgn0262721 Length:95 Species:Drosophila melanogaster
Sequence 2:NP_957412.2 Gene:ambp / 394093 ZFINID:ZDB-GENE-040426-1608 Length:346 Species:Danio rerio


Alignment Length:73 Identity:23/73 - (31%)
Similarity:31/73 - (42%) Gaps:17/73 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 PPAVNGN-----------------DFIKCAGSFEKFSYYPHINVCQKFEYGGCFGNDNSFNTLEK 75
            |||..|:                 |...|.|...:|.|...|..||.|.:|||.||.|:|.|.:.
Zfish   206 PPAEEGSGDDMPMFRGPDACKSEPDSGPCFGMLTRFHYNSSIMSCQMFTFGGCMGNQNNFPTEKD 270

  Fly    76 CHKKCKLD 83
            |.:.|:.:
Zfish   271 CLQSCRTE 278

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43165NP_001245858.1 Kunitz-type 24..80 CDD:444694 22/68 (32%)
ambpNP_957412.2 lipocalin_A1M-like 24..186 CDD:381193
Kunitz_bikunin_1-like 223..276 CDD:438639 18/52 (35%)
Kunitz_bikunin_2-like 278..332 CDD:438640 0/1 (0%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.