DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43165 and SPINT4

DIOPT Version :10

Sequence 1:NP_001245858.1 Gene:CG43165 / 12798550 FlyBaseID:FBgn0262721 Length:95 Species:Drosophila melanogaster
Sequence 2:NP_848550.1 Gene:SPINT4 / 391253 HGNCID:16130 Length:99 Species:Homo sapiens


Alignment Length:81 Identity:23/81 - (28%)
Similarity:35/81 - (43%) Gaps:11/81 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MRLVVLGCLL-----LALETVGL----CLKDPICG--QPPAVNGNDFIKCAGSFEKFSYYPHINV 54
            |:...||.||     .:|.|:.|    .:.:.|||  :.|.....:|..|.....::.|......
Human     1 MKSAKLGFLLRFFIFCSLNTLLLGGVNKIAEKICGDLKDPCKLDMNFGSCYEVHFRYFYNRTSKR 65

  Fly    55 CQKFEYGGCFGNDNSF 70
            |:.|.:.||.||.|:|
Human    66 CETFVFSGCNGNLNNF 81

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43165NP_001245858.1 Kunitz-type 24..80 CDD:444694 15/49 (31%)
SPINT4NP_848550.1 Kunitz-type 41..91 CDD:438633 11/41 (27%)

Return to query results.
Submit another query.