DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43165 and K11D12.13

DIOPT Version :10

Sequence 1:NP_001245858.1 Gene:CG43165 / 12798550 FlyBaseID:FBgn0262721 Length:95 Species:Drosophila melanogaster
Sequence 2:NP_001033498.1 Gene:K11D12.13 / 3896821 WormBaseID:WBGene00044535 Length:188 Species:Caenorhabditis elegans


Alignment Length:74 Identity:24/74 - (32%)
Similarity:37/74 - (50%) Gaps:9/74 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 PICGQPPAVNGNDFIKCAGSFE---KFSYYPHINVCQKFEYGGCFGNDNSFNTLEKCHKKCKLDW 84
            |.|..|.|...:.  .|  |:|   ::.:.|..|:|..|:|.||.||.|::.|...|.:.|.:|.
 Worm    20 PKCYLPQAKGTSS--NC--SYEASIRYHFDPKTNICHAFKYEGCGGNVNNYETPGDCGQNCNVDE 80

  Fly    85 NTLYFLNCA 93
            .|  ::.||
 Worm    81 KT--YIQCA 87

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43165NP_001245858.1 Kunitz-type 24..80 CDD:444694 18/58 (31%)
K11D12.13NP_001033498.1 Kunitz-type 22..76 CDD:438633 18/57 (32%)

Return to query results.
Submit another query.