| Sequence 1: | NP_001245858.1 | Gene: | CG43165 / 12798550 | FlyBaseID: | FBgn0262721 | Length: | 95 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001296732.1 | Gene: | tfpia / 359833 | ZFINID: | ZDB-GENE-030711-1 | Length: | 279 | Species: | Danio rerio |
| Alignment Length: | 44 | Identity: | 17/44 - (38%) |
|---|---|---|---|
| Similarity: | 28/44 - (63%) | Gaps: | 0/44 - (0%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 39 CAGSFEKFSYYPHINVCQKFEYGGCFGNDNSFNTLEKCHKKCKL 82 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CG43165 | NP_001245858.1 | Kunitz-type | 24..80 | CDD:444694 | 15/40 (38%) |
| tfpia | NP_001296732.1 | Kunitz_TFPI1_1-like | 39..93 | CDD:438656 | |
| Kunitz-type | 101..151 | CDD:438633 | 15/40 (38%) | ||
| Kunitz-type | 202..255 | CDD:444694 | |||
| Blue background indicates that the domain is not in the aligned region. | |||||