DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43165 and CG13748

DIOPT Version :10

Sequence 1:NP_001245858.1 Gene:CG43165 / 12798550 FlyBaseID:FBgn0262721 Length:95 Species:Drosophila melanogaster
Sequence 2:NP_610430.1 Gene:CG13748 / 35896 FlyBaseID:FBgn0033355 Length:113 Species:Drosophila melanogaster


Alignment Length:53 Identity:17/53 - (32%)
Similarity:27/53 - (50%) Gaps:4/53 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 PAVNGNDFIKCAGSFEKFSYYPHINVCQKFEYGGCFGNDNSFNTLEKCHKKCK 81
            ||..|    .|.....::.|.|....|.:|::|||.||:|:|.:.:.|...|:
  Fly    63 PARKG----VCRALIPRWRYDPEQKKCVEFKFGGCDGNENNFASYKDCMSTCE 111

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43165NP_001245858.1 Kunitz-type 24..80 CDD:444694 16/50 (32%)
CG13748NP_610430.1 Kunitz-type 57..112 CDD:444694 17/53 (32%)

Return to query results.
Submit another query.