DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43165 and CG10031

DIOPT Version :10

Sequence 1:NP_001245858.1 Gene:CG43165 / 12798550 FlyBaseID:FBgn0262721 Length:95 Species:Drosophila melanogaster
Sequence 2:NP_608802.2 Gene:CG10031 / 33594 FlyBaseID:FBgn0031563 Length:129 Species:Drosophila melanogaster


Alignment Length:59 Identity:23/59 - (38%)
Similarity:29/59 - (49%) Gaps:5/59 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 DPICGQPPAVNGNDFIKCAGSFEKFSYYPHINVCQKFEYGGCFGNDNSFNTLEKCHKKC 80
            ||.|.||..|.     .|..|.|:|.|......|:.|:||||.||||.:...:.|.:.|
  Fly    72 DPKCLQPLDVG-----PCRMSLERFYYNKDSKACETFKYGGCRGNDNRWGFRQTCEEAC 125

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43165NP_001245858.1 Kunitz-type 24..80 CDD:444694 20/55 (36%)
CG10031NP_608802.2 Kunitz-type 75..125 CDD:438633 20/54 (37%)

Return to query results.
Submit another query.