DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43165 and CG3604

DIOPT Version :10

Sequence 1:NP_001245858.1 Gene:CG43165 / 12798550 FlyBaseID:FBgn0262721 Length:95 Species:Drosophila melanogaster
Sequence 2:NP_608801.1 Gene:CG3604 / 33593 FlyBaseID:FBgn0031562 Length:132 Species:Drosophila melanogaster


Alignment Length:56 Identity:19/56 - (33%)
Similarity:29/56 - (51%) Gaps:5/56 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 CGQPPAVNGNDFIKCAGSFEKFSYYPHINVCQKFEYGGCFGNDNSFNTLEKCHKKC 80
            |.||....     :|...|.:::|......|::|.||||.||.|:|.:.|:|.:.|
  Fly    55 CHQPKETG-----RCFALFYRYAYNVDTQSCEEFVYGGCAGNKNNFESKEQCEQAC 105

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43165NP_001245858.1 Kunitz-type 24..80 CDD:444694 18/54 (33%)
CG3604NP_608801.1 Kunitz-type 55..105 CDD:438633 18/54 (33%)

Return to query results.
Submit another query.