DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43165 and CG16704

DIOPT Version :10

Sequence 1:NP_001245858.1 Gene:CG43165 / 12798550 FlyBaseID:FBgn0262721 Length:95 Species:Drosophila melanogaster
Sequence 2:NP_608797.1 Gene:CG16704 / 33589 FlyBaseID:FBgn0031558 Length:79 Species:Drosophila melanogaster


Alignment Length:80 Identity:28/80 - (35%)
Similarity:40/80 - (50%) Gaps:4/80 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 LVVLGCLLLALETVGLCLKDPICGQPPAVNGNDFIKCAGSFEKFSYYPHINVCQKFEYGGCFGND 67
            |||...:...:.:....||:||||:...|.|.    |......::|.|..|.|..|.|.||.||:
  Fly     4 LVVFALICCLVASAFATLKNPICGEEFGVKGT----CRSLQPMWTYRPDTNECFTFNYSGCHGNN 64

  Fly    68 NSFNTLEKCHKKCKL 82
            |.|:...:|.:|||:
  Fly    65 NLFHKKLECEEKCKI 79

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43165NP_001245858.1 Kunitz-type 24..80 CDD:444694 19/55 (35%)
CG16704NP_608797.1 Kunitz-type 32..77 CDD:444694 16/48 (33%)

Return to query results.
Submit another query.