| Sequence 1: | NP_001245858.1 | Gene: | CG43165 / 12798550 | FlyBaseID: | FBgn0262721 | Length: | 95 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001373281.1 | Gene: | tfpil / 322379 | ZFINID: | ZDB-GENE-030131-1098 | Length: | 211 | Species: | Danio rerio |
| Alignment Length: | 42 | Identity: | 15/42 - (35%) |
|---|---|---|---|
| Similarity: | 21/42 - (50%) | Gaps: | 0/42 - (0%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 39 CAGSFEKFSYYPHINVCQKFEYGGCFGNDNSFNTLEKCHKKC 80 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CG43165 | NP_001245858.1 | Kunitz-type | 24..80 | CDD:444694 | 14/40 (35%) |
| tfpil | NP_001373281.1 | Kunitz_conkunitzin | 27..77 | CDD:438636 | |
| Kunitz-type | 93..143 | CDD:438633 | 14/40 (35%) | ||
| Blue background indicates that the domain is not in the aligned region. | |||||