DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43165 and Acp24A4

DIOPT Version :10

Sequence 1:NP_001245858.1 Gene:CG43165 / 12798550 FlyBaseID:FBgn0262721 Length:95 Species:Drosophila melanogaster
Sequence 2:NP_001036330.1 Gene:Acp24A4 / 318936 FlyBaseID:FBgn0051779 Length:78 Species:Drosophila melanogaster


Alignment Length:80 Identity:37/80 - (46%)
Similarity:49/80 - (61%) Gaps:4/80 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MRLVVLGCLLLALETVGLCLKDPICGQPPAVNGNDFIKCAGSFEKFSYYPHINVCQKFEYGGCFG 65
            |:|::|..:.:||.:..|.||:.|||.|.|.|||    |...|.::||....|||..|.||||.|
  Fly     1 MKLLILLFVFIALASNSLALKNEICGLPAAANGN----CLALFSRWSYDAQYNVCFNFIYGGCQG 61

  Fly    66 NDNSFNTLEKCHKKC 80
            |:|||.:.|:|..||
  Fly    62 NENSFESQEECINKC 76

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43165NP_001245858.1 Kunitz-type 24..80 CDD:444694 27/55 (49%)
Acp24A4NP_001036330.1 Kunitz-type 25..76 CDD:438633 26/54 (48%)

Return to query results.
Submit another query.