DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43165 and Col28a1

DIOPT Version :10

Sequence 1:NP_001245858.1 Gene:CG43165 / 12798550 FlyBaseID:FBgn0262721 Length:95 Species:Drosophila melanogaster
Sequence 2:NP_001418648.1 Gene:Col28a1 / 312115 RGDID:1564680 Length:1141 Species:Rattus norvegicus


Alignment Length:60 Identity:18/60 - (30%)
Similarity:30/60 - (50%) Gaps:5/60 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 KDPICGQPPAVNGNDFIKCAGSFEKFSYYPHINVCQKFEYGGCFGNDNSFNTLEKCHKKC 80
            |||.| :.....||    |.....::.|...:|.|.:|.:.||.|:.|.|::.::|.:.|
  Rat  1084 KDPRC-EEALKPGN----CGDYVVRWYYDKQVNSCARFWFSGCNGSGNRFHSEKECQETC 1138

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43165NP_001245858.1 Kunitz-type 24..80 CDD:444694 14/55 (25%)
Col28a1NP_001418648.1 vWFA_subfamily_ECM 47..212 CDD:238727
gly_rich_SclB <257..446 CDD:468478
gly_rich_SclB <363..632 CDD:468478
Collagen 713..772 CDD:460189
VWA 798..974 CDD:459670
Kunitz-type 1088..1138 CDD:444694 14/54 (26%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.