DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43165 and Spint2

DIOPT Version :10

Sequence 1:NP_001245858.1 Gene:CG43165 / 12798550 FlyBaseID:FBgn0262721 Length:95 Species:Drosophila melanogaster
Sequence 2:NP_001076018.1 Gene:Spint2 / 292770 RGDID:735123 Length:250 Species:Rattus norvegicus


Alignment Length:53 Identity:21/53 - (39%)
Similarity:27/53 - (50%) Gaps:4/53 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 PPAVNGNDFIKCAGSFEKFSYYPHINVCQKFEYGGCFGNDNSFNTLEKCHKKC 80
            |.||.|    .|..:|.::.|....|.|..|.||||.||.||:.:.|.|.:.|
  Rat   133 PKAVTG----PCRAAFPRWYYDVEKNSCSSFIYGGCRGNKNSYLSQEACMQHC 181

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43165NP_001245858.1 Kunitz-type 24..80 CDD:444694 20/51 (39%)
Spint2NP_001076018.1 Kunitz_HAI2_1-like 36..88 CDD:438664
Kunitz_HAI2_2-like 129..181 CDD:438665 20/51 (39%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.