| Sequence 1: | NP_001245858.1 | Gene: | CG43165 / 12798550 | FlyBaseID: | FBgn0262721 | Length: | 95 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001385521.1 | Gene: | Wfikkn2 / 287631 | RGDID: | 1305361 | Length: | 571 | Species: | Rattus norvegicus |
| Alignment Length: | 75 | Identity: | 24/75 - (32%) |
|---|---|---|---|
| Similarity: | 35/75 - (46%) | Gaps: | 14/75 - (18%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 8 CLLLALETVGLCLKDPI--CGQPPAVNGNDFIKCAGSFEKFSYYPHINVCQKFEYGGCFGNDNSF 70
Fly 71 NTLEKCHKKC 80 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CG43165 | NP_001245858.1 | Kunitz-type | 24..80 | CDD:444694 | 19/57 (33%) |
| Wfikkn2 | NP_001385521.1 | WAP | 37..86 | CDD:459672 | |
| KAZAL_FS | 133..169 | CDD:238052 | |||
| IgI_3_WFIKKN-like | 205..299 | CDD:409422 | |||
| Ig strand A | 205..208 | CDD:409422 | |||
| Ig strand A' | 213..216 | CDD:409422 | |||
| Ig strand B | 221..228 | CDD:409422 | |||
| Ig strand C | 235..240 | CDD:409422 | |||
| Ig strand C' | 241..243 | CDD:409422 | |||
| Ig strand D | 245..250 | CDD:409422 | |||
| Ig strand E | 258..264 | CDD:409422 | |||
| Ig strand F | 278..286 | CDD:409422 | |||
| Ig strand G | 289..299 | CDD:409422 | |||
| Kunitz_WFIKKN_1-like | 322..373 | CDD:438648 | 2/10 (20%) | ||
| Kunitz_WFIKKN_2-like | 380..432 | CDD:438649 | 20/57 (35%) | ||
| NTR_WFIKKN | 450..558 | CDD:239630 | |||
| Blue background indicates that the domain is not in the aligned region. | |||||