| Sequence 1: | NP_001245858.1 | Gene: | CG43165 / 12798550 | FlyBaseID: | FBgn0262721 | Length: | 95 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | XP_006533560.1 | Gene: | Wfikkn2 / 278507 | MGIID: | 2669209 | Length: | 585 | Species: | Mus musculus |
| Alignment Length: | 75 | Identity: | 25/75 - (33%) |
|---|---|---|---|
| Similarity: | 35/75 - (46%) | Gaps: | 14/75 - (18%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 8 CLLLALETVGLCLKDP--ICGQPPAVNGNDFIKCAGSFEKFSYYPHINVCQKFEYGGCFGNDNSF 70
Fly 71 NTLEKCHKKC 80 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CG43165 | NP_001245858.1 | Kunitz-type | 24..80 | CDD:444694 | 20/55 (36%) |
| Wfikkn2 | XP_006533560.1 | WAP | 51..100 | CDD:459672 | |
| KAZAL_FS | 147..183 | CDD:238052 | |||
| IgI_3_WFIKKN-like | 219..313 | CDD:409422 | |||
| Ig strand A | 219..222 | CDD:409422 | |||
| Ig strand A' | 227..230 | CDD:409422 | |||
| Ig strand B | 235..242 | CDD:409422 | |||
| Ig strand C | 249..254 | CDD:409422 | |||
| Ig strand C' | 255..257 | CDD:409422 | |||
| Ig strand D | 259..264 | CDD:409422 | |||
| Ig strand E | 272..278 | CDD:409422 | |||
| Ig strand F | 292..300 | CDD:409422 | |||
| Ig strand G | 303..313 | CDD:409422 | |||
| Kunitz_WFIKKN_1-like | 336..387 | CDD:438648 | 2/10 (20%) | ||
| Kunitz_WFIKKN_2-like | 394..446 | CDD:438649 | 21/57 (37%) | ||
| NTR_WFIKKN | 464..572 | CDD:239630 | |||
| Blue background indicates that the domain is not in the aligned region. | |||||