| Sequence 1: | NP_001245858.1 | Gene: | CG43165 / 12798550 | FlyBaseID: | FBgn0262721 | Length: | 95 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_035706.1 | Gene: | Tfpi / 21788 | MGIID: | 1095418 | Length: | 306 | Species: | Mus musculus |
| Alignment Length: | 43 | Identity: | 18/43 - (41%) |
|---|---|---|---|
| Similarity: | 27/43 - (62%) | Gaps: | 0/43 - (0%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 39 CAGSFEKFSYYPHINVCQKFEYGGCFGNDNSFNTLEKCHKKCK 81 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CG43165 | NP_001245858.1 | Kunitz-type | 24..80 | CDD:444694 | 17/40 (43%) |
| Tfpi | NP_035706.1 | Kunitz_TFPI1_1-like | 47..101 | CDD:438656 | |
| Kunitz_TFPI1_2-like | 117..172 | CDD:438657 | 17/41 (41%) | ||
| Kunitz_TFPI1_TFPI2_3-like | 223..275 | CDD:438658 | |||
| Blue background indicates that the domain is not in the aligned region. | |||||