DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43165 and ZK287.4

DIOPT Version :10

Sequence 1:NP_001245858.1 Gene:CG43165 / 12798550 FlyBaseID:FBgn0262721 Length:95 Species:Drosophila melanogaster
Sequence 2:NP_001256133.1 Gene:ZK287.4 / 191282 WormBaseID:WBGene00013965 Length:1285 Species:Caenorhabditis elegans


Alignment Length:71 Identity:22/71 - (30%)
Similarity:31/71 - (43%) Gaps:10/71 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 LETVGLCLKDPI---CGQPPAVNGNDFIKCAGSFEKFSYYPHINVCQKFEYGGCFGNDNSFNTLE 74
            |||.|  :..|.   |..|||:....|     :..::.:......|::|.|.|..||||.|....
 Worm   305 LETCG--IGKPTRKSCELPPAIGNGPF-----NIPRYYFDRVTKKCERFFYSGRDGNDNRFYKKN 362

  Fly    75 KCHKKC 80
            ||.:.|
 Worm   363 KCERLC 368

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43165NP_001245858.1 Kunitz-type 24..80 CDD:444694 16/58 (28%)
ZK287.4NP_001256133.1 Lustrin_cystein 45..91 CDD:464222
Kunitz_BPTI 99..151 CDD:425421
Kunitz_conkunitzin 257..308 CDD:438636 2/2 (100%)
KU 318..368 CDD:197529 16/54 (30%)
Kunitz_conkunitzin 846..896 CDD:438636
Kunitz_conkunitzin 995..1043 CDD:438636
Kunitz_conkunitzin 1054..1104 CDD:438636
Lustrin_cystein 1148..1189 CDD:464222
KU <1215..1259 CDD:197529
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.