| Sequence 1: | NP_001245858.1 | Gene: | CG43165 / 12798550 | FlyBaseID: | FBgn0262721 | Length: | 95 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_505943.2 | Gene: | piit-1 / 185259 | WormBaseID: | WBGene00009384 | Length: | 200 | Species: | Caenorhabditis elegans |
| Alignment Length: | 51 | Identity: | 20/51 - (39%) |
|---|---|---|---|
| Similarity: | 26/51 - (50%) | Gaps: | 5/51 - (9%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 32 NGNDFIKCA--GSFEKFSYYPHINVCQKFEYGGCFGNDNSFNTLEKCHKKC 80 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CG43165 | NP_001245858.1 | Kunitz-type | 24..80 | CDD:444694 | 19/49 (39%) |
| piit-1 | NP_505943.2 | Kunitz_BPTI | 24..77 | CDD:425421 | 19/49 (39%) |
| KU | 137..192 | CDD:197529 | |||
| Blue background indicates that the domain is not in the aligned region. | |||||