| Sequence 1: | NP_001245858.1 | Gene: | CG43165 / 12798550 | FlyBaseID: | FBgn0262721 | Length: | 95 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_506123.2 | Gene: | C54D10.10 / 183787 | WormBaseID: | WBGene00008304 | Length: | 216 | Species: | Caenorhabditis elegans |
| Alignment Length: | 36 | Identity: | 15/36 - (41%) |
|---|---|---|---|
| Similarity: | 19/36 - (52%) | Gaps: | 0/36 - (0%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 45 KFSYYPHINVCQKFEYGGCFGNDNSFNTLEKCHKKC 80 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CG43165 | NP_001245858.1 | Kunitz-type | 24..80 | CDD:444694 | 14/34 (41%) |
| C54D10.10 | NP_506123.2 | Kunitz_BPTI | 21..75 | CDD:425421 | 15/36 (42%) |
| KU | 158..213 | CDD:197529 | |||
| Blue background indicates that the domain is not in the aligned region. | |||||